KEGG   Yarrowia lipolytica: YALI0C16434gHelp
Entry
YALI0C16434g      CDS       T01033                                 

Definition
YALI0C16434p
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
yli  Yarrowia lipolytica
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    YALI0C16434g
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     YALI0C16434g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:2320971..2321537
Genome map
AA seq 188 aa AA seqDB search
MSNLAPIVISGPSGTGKSTLLKRLLAEYPDRFGFSISYTTRKPRDGEVDGKDYNFVTVDQ
FKKLIEDGAFIEWAQFGGNYYGTAVAGVKKVADNNQQCILDIDMQGVKAVKKSDLKARYL
FVAPPSIEELRSRLTGRGTETDESLEKRLAAAEGELAYSKEPGAHDLVIVNDDLDKAYKQ
FKQFIVGE
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatctcgcacccatcgtcatctcgggccccagtggaaccggcaagtccactctt
ctcaagcgactgctggccgaataccccgaccggttcggcttctccatttcctacaccacc
cgaaagccccgagacggagaagtcgacggcaaggactacaactttgtgactgtggaccag
ttcaaaaagctgattgaggatggagccttcatcgaatgggcccagttcggaggcaactac
tacggcaccgccgtcgccggagtcaagaaggtggccgacaacaaccagcagtgcattctc
gacattgatatgcagggagtcaaggccgtcaagaagtccgatctcaaggcccgatacctt
tttgtcgctcctccttccatcgaggagctgcgatctcgactcaccggccgaggaacggag
accgacgagtctctggagaagcgtctggctgctgccgagggagagctcgcctactccaag
gagcctggagcccatgatcttgtcattgttaacgatgatctcgacaaggcctacaagcag
ttcaagcagtttattgttggagagtaa

DBGET integrated database retrieval system