KEGG   Yarrowia lipolytica: YALI0C16665gHelp
Entry
YALI0C16665g      CDS       T01033                                 

Definition
YALI0C16665p
Orthology
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     YALI0C16665g
Protein kinases [BR:yli01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   YALI0C16665g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:complement(2348673..2351411)
Genome map
AA seq 912 aa AA seqDB search
MDHSPSPHHRKMSSNGHLMPSLIGHKQQQQHQQQQQQQQQQPPYPTDYYRKSFESAPNVS
ASSSAAAASSTSAGMGSPHMSHSQRSLYYHQQQMGPFSPSQPHPQFQTSMSNALSTQQLP
HPQLMHQYEPSSPVSTRRPSHEPSHYPPTQTQYGLPPGLQHQQHSSPHEPLYRSQPGTPL
APQMQPGTPLGSVQMSSSPVTPQSASYNPWASPHSTPAGNYARSRVSPVRKGQPSQQPQQ
QQQQQHQQTPQQHYNPAMPATKPYYWTQQAQQTPQTQPPPITAPQSAPQAVHVAPQPIHA
APPQPPIQPQPQPQEPPASIPPPSFRPVERASDLNPQVNPRPQNRRAIPEGGYMSPLMCL
TLQLSATYQICNSGFNYESSKNPRRVLTKPSEPKLNNGHDNRDNDYILYVNDVLGTDENK
RYLVLDILGQGTFGQVVKCQNMKTKDIVAVKVIKNNPAFLNQSMMEVSILEYLNNSVDNK
DEHHILRLKDKFLHKQHYCLVFELLSSNLYELLKQNQFRGLSINLVRVFSRQLLDSLTVL
KNAKLIHCDLKPENILLKNLDSPIIKVIDFGSACHERKTVYTYIQSRFYRSPEVLLGIPY
TTSIDMWSMGCIIAELFLGLPIFPGASEYNQLSRIVASLGDPPNWMVEMGKNSGKFMEKI
VDDQGRKRYRLKSRERYSREFNVDEKESKQYFTSANLKTIIMEYPLHKKDMKRADIDKEM
LNREALYDFLMGLLNYNPFERWTPQQAASHPFITESKFTGPFVPHPKEEKDVFHPTPTAQ
PISQSQPLHAQGQNANAMVPPGPAAGSSAAQTSAEAAQYAHMQPPANWSTGLKQQNSGSG
SRRPRALTYGSMDPIPPPIQRATAMVNPADHIQAQPSPAYIPPSELTRNHQGQGNEYGEV
VRKLENGLMSRW
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atggaccattcgccgtcgccgcatcaccgcaaaatgtcgtccaacgggcacctgatgccg
tcgctgatcggacacaaacagcagcagcagcatcagcagcagcaacaacagcaacaacaa
cagccaccgtacccgacagactactaccgtaagagctttgagagcgcgcccaacgtgtcg
gcctcgagctcggcagccgctgcctcttcaacttcagcaggaatgggatctccgcacatg
tcccactcacaacgcagtctgtactaccaccaacagcagatgggtcctttttcgccctcg
caaccgcatccgcagttccagacgtccatgtccaacgccctgtcgacccaacagctgccc
cacccgcagctcatgcaccaatacgagccctcgtcgcctgtgtcgacccgcagaccctca
cacgaacccagccactatcccccgacgcagacacagtacggcctgccccccgggctccag
catcaacaacattcgtcgccacatgaaccgctgtataggtcgcaacccggcacgccactg
gcacctcagatgcagcccggcactcctctgggatcagtgcaaatgtcctcttcacctgta
acgccccaatcggcttcttacaacccctgggcgtcccctcacagcacccccgcaggcaac
tacgcccgatcgcgggtgtcaccggtgcgcaaaggccaaccatctcaacaaccccagcag
cagcagcagcagcagcatcaacagacaccccagcagcattacaatcccgccatgccggca
acaaagccatactattggacgcaacaggcacaacaaacacctcaaacacaaccacctccc
atcacagctcctcagtcggcccctcaagcggtacacgtggctcctcagcccattcatgca
gctccaccacagccaccgatacagcctcagccgcaaccgcaggagccgcctgcgtcaatt
cctcctccatccttccgaccggttgaacgggcttctgacctcaatccccaggtcaaccca
agaccccagaatcgtcgggcaatccccgagggcggctacatgtcgcctctcatgtgtctg
acgttgcagctgtcagccacgtaccagatctgcaactcgggcttcaactacgagtcgtcc
aagaacccacgcagggtgctcaccaagcccagtgagccgaagcttaacaatggccacgac
aacagagacaacgactacattctgtacgttaatgacgtcctgggtactgacgaaaacaag
cgctatctggtactagatattttgggtcagggtacgtttgggcaagtggtcaagtgccag
aacatgaagactaaggatattgtggcggtcaaggtgattaagaacaacccagcgttctta
aaccagagcatgatggaggtgtcgattcttgagtacctgaataactcggtcgacaacaag
gacgagcaccacattttgcggctcaaggacaagtttttgcataagcaacattactgtctc
gtgtttgagctgctgagttctaacctctacgaacttctcaaacagaaccagttccggggc
ttgtctatcaatctcgtcagggtgttttctcgccagcttctggactctctcacagtgctg
aaaaacgccaaactcatccattgtgatctcaagcccgaaaacattttgctcaaaaacctc
gatagtcccattatcaaggtgattgactttgggtctgcttgccacgaaagaaaaactgtc
tacacatatatccaatcgcggttttaccgatcgcccgaggtgttgctcggtatcccatat
accacctccatcgacatgtggtccatgggctgcatcattgccgagctattcctcggtctt
cccatcttccctggagcgtctgagtacaaccagctgtctcgaatagtggcatctctgggt
gaccctcctaattggatggttgagatgggcaagaacagcggcaagttcatggaaaagatt
gtggacgaccagggccgcaagcgataccggctcaagtcgcgggagcgatactcccgtgag
tttaacgtggatgaaaaggagtccaagcagtacttcacatctgcaaatctcaaaaccatt
atcatggagtaccccttgcataagaaggatatgaagcgggcggatattgacaaggagatg
ctcaaccgcgaggcgctgtatgatttcctcatgggtttgctcaactacaatccctttgag
cggtggactcctcaacaggcggcatctcatccgttcatcaccgagtccaagttcacaggt
ccctttgtgccacatcccaaggaagaaaaggacgtcttccaccccacaccgacagcccag
cccatttcgcagtcccagcctctacacgctcagggccagaacgccaatgccatggtcccc
cccggcccagctgcaggctcctccgcagctcagacgtctgctgaggcggcgcagtatgca
cacatgcagcctcctgccaactggagcaccggtctgaagcagcagaactcgggttcgggt
tcgagacgaccgcgagcgttgacatatggatccatggatcccattccgccgcctattcag
agagcaacggctatggttaatcctgcggaccatatccaggcccaacccagtcccgcgtac
attcctccatcagagctgaccaggaatcaccagggacagggaaacgagtatggtgaggtg
gtgagaaagttggagaatgggttgatgagtcggtggtag

DBGET integrated database retrieval system