KEGG   Yarrowia lipolytica: YALI0C16885gHelp
Entry
YALI0C16885g      CDS       T01033                                 

Definition
YALI0C16885p
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
yli  Yarrowia lipolytica
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YALI0C16885g
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YALI0C16885g
Enzymes [BR:yli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     YALI0C16885g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:join(2381364,2381723..2383344)
Genome map
AA seq 540 aa AA seqDB search
MSEQQRFNNEVEEIKKWWSSPRWKHTKRVYSPEDIASRRGTIKVPQASSQQADKLFKLLQ
EHEKNHTASFTYGALDPVQVTQMAKYLDSIYVSGWQSSSTASTSNEPSPDLADYPMDTVP
NKVEHLWFAQLFHDRKQNEERLSLPESERSKLPAPVDYLRPIIADADTGHGGLTAVVKLT
KMFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPIQEHINRLIAIRASADIFGSDLLAIAR
TDSEAATLITSSIDYRDHYFIAGATNKDAGHLVDVMVAAELEGKQGAALQAVEDEWNRKA
GVKLFHEAFADEVNAGSYSNKAELIAEFNKKVTPLSNTPALEARALAARLLGKDIYFNWE
AARVREGYYRYQGGTQCAVNRGIAYAPYADLIWMESKLPDYAQAKEFAEGVKNAVPHQWL
AYNLSPSFNWTTAMSPEDQETYISRLAKLGYVWQFITLAGLHTNALISDKFAKAYSERGM
KAYGGEIQQPEIDQGCEVVKHQKWSGAEYIDGILRMVTGGITSTAAMGAGVTEDQFKSKL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaacagcagcgattcaacaacgaagtcgaggagatcaagaagtggtggtcttcc
ccccgatggaagcacaccaagcgtgtctactctcccgaggacattgcctcccgacgagga
accatcaaggtcccccaggcctcttctcagcaggctgacaagctcttcaagctgctccag
gagcacgagaagaaccacaccgcctccttcacctacggtgccctcgaccccgtccaggtg
acccagatggccaagtacctcgactccatctacgtttccggatggcagtcttcttctacc
gcctccacctccaacgagccctctcccgatctggctgactaccccatggacaccgtcccc
aacaaggtcgagcacctgtggtttgcccagctcttccacgaccgaaagcagaacgaggag
cgactgtctctgcctgagtccgagcgatccaagctccccgcccccgtcgactacctgcga
cccatcatcgccgatgccgacaccggtcacggaggtcttactgccgtcgtcaagctcacc
aagatgttcatcgagcgaggtgccgccggtatccacattgaggaccaggctcccggtacc
aagaagtgcggtcacatggccggtaaggttcttgtccctatccaggagcacatcaaccga
ctgattgccatccgagcttctgccgatatcttcggctctgacctcctggccattgcccga
accgattccgaggctgctactcttatcacctcttccatcgactaccgagaccattacttc
attgctggtgccaccaacaaggatgctggccacctcgtcgacgtcatggtcgccgccgag
ctcgagggcaagcagggcgccgccctccaggccgttgaggacgagtggaaccgaaaggcc
ggtgtcaagctcttccacgaggctttcgccgatgaggtcaacgccggctcttactccaac
aaggctgagctcatcgccgagttcaacaagaaggtcacccctctgtctaacacccccgct
cttgaggcccgagctctggctgctcgactcctcggcaaggacatctacttcaactgggag
gctgcccgagtccgagagggctactaccgataccagggaggaacccagtgtgccgtcaac
cgaggtattgcttacgctccctacgctgacctcatctggatggagtccaagctgcccgac
tacgctcaggccaaggagttcgccgagggtgtcaagaacgccgtcccccaccagtggctg
gcttacaacctgtctccctctttcaactggaccaccgccatgtcgcccgaggaccaggag
acctacatcagccgactggccaagctcggctacgtgtggcagttcatcactctggccggt
ctgcacaccaacgctctcatctccgacaagttcgccaaggcttactctgagcgaggcatg
aaggcttacggtggtgagatccagcagcccgagattgaccagggttgtgaggttgtcaag
caccagaagtggtccggtgctgagtacattgacggtatcctgcgaatggttaccggaggt
atcacctctaccgccgccatgggtgccggtgtcactgaggaccagttcaagtccaagctt
taa

DBGET integrated database retrieval system