KEGG   Yarrowia lipolytica: YALI0C21582gHelp
Entry
YALI0C21582g      CDS       T01033                                 

Definition
YALI0C21582p
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
yli  Yarrowia lipolytica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:join(2895431..2895432,2895739..2897125)
Genome map
AA seq 462 aa AA seqDB search
MIPSRPLFQGWKFTPELAEKIKHYARFPATGVSLRQMVQFGSKPSAGTLFRASQFISEEL
PIRLAHRVRDLEDLPDGLSEQPSILRVRNWYAQSFDELTSLKQPKISKELKTLLYSGGNN
NNGNSNGNGASTTNNGNSNTRSFHMSSTRQTLLPENTTNPSLDEYHFKSTPTQKTVNRRR
YYANVSPEVSSWPPEVYEFNKTITATLQKIKQRHDPVVTTVAQGITEWKQVYKKSAASLS
IQSFLDRFYMSRIGIRMLIGQHIALNLHAKQEDYVGIICTKTNVREVVQDAIANARFICE
DWYGLFEAPKVEIVCQPDINFMYVPGHLSHMLFETLKNSLRAVVETHGVDADYYPPVKVI
VAEGHEDITIKISDEGGGIPRSAIPLIWTYLYTTVEATPSLEPDFNKSDFKAPMAGFGYG
LPISRLYARYFGGDLKLISMEGYGTDVYLHLNRLSSSSEPLQ
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgataccatcaaggcctcttttccagggctggaagttcacgcccgaacttgcagagaaa
atcaaacactacgcacgattccccgccaccggagtctctctccgacaaatggtgcagttc
ggaagcaaacccagtgccggcactctgttcagagcgtcccagttcatttccgaagagctg
cccattcgactcgcccaccgagtgcgggatctcgaagacctgccagacggactctcggag
caacctagcattctgcgggtgcgaaactggtatgcccagagtttcgacgagctcacgtcg
ctgaagcagcccaaaatcagcaaggagctgaagaccctgctttacagcggaggtaacaac
aacaacggcaacagcaatggcaacggagccagcacaaccaacaacggcaacagcaatacc
cggtcattccacatgtcgagcacgcggcagaccctactccctgaaaacacaactaatcct
tcgctggacgaataccacttcaagtcgacccccacgcaaaaaacagtcaaccgacgaaga
tactacgccaacgtgtcgcccgaagtgtcctcatggccaccggaggtctacgagtttaac
aaaaccatcacagctactctgcagaagatcaagcagcggcatgaccctgtcgtgaccacg
gtcgctcagggtatcaccgagtggaagcaggtgtacaagaagtctgctgcttccttgtcc
atacaatccttcctggaccgtttctacatgtctcgtattggtattcgaatgctcatcggc
cagcatattgctctcaacttacacgccaagcaggaggattacgtcggaatcatttgcaca
aagactaacgttcgagaagttgttcaggacgccatcgccaacgctagattcatctgcgag
gactggtacggactgttcgaggcgcccaaggtagagattgtctgccagcccgacatcaac
ttcatgtacgttcccggtcatctgtcgcatatgcttttcgagacgctcaagaactctctt
cgagccgttgtcgagactcatggagtcgatgccgactactaccctcccgtcaaggtgatt
gtggctgagggtcatgaggatatcactatcaagatctccgatgagggaggaggaatcccc
cggtccgccattcctctcatctggacttatctgtacaccacagtcgaagccactcccagc
ctggagcccgacttcaacaagtctgactttaaggcccccatggctggtttcggatacggt
ctccctatttcgcggctgtatgcccgatactttggaggcgatctgaagctcatttccatg
gagggatacggtacagatgtttatctgcatctcaatagattgtcgtcttcttctgagcct
ctgcagtaa

DBGET integrated database retrieval system