KEGG   Yarrowia lipolytica: YALI0C23364gHelp
Entry
YALI0C23364g      CDS       T01033                                 

Definition
YALI0C23364p
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
yli  Yarrowia lipolytica
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:yli00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
C:complement(3125149..3127377)
Genome map
AA seq 742 aa AA seqDB search
MASATGIDTGSDQLRHRTGLAEKQANALSATHHNVIEPEDTKTRKATTSTAEQGTFYEIE
RIMGPIIFTALALFTRLYRIGVSNIVTWDEAHFGKFGSYYLKREYYFDVHPPLGKMLVGL
SGYLAGYNGSFGFESGHTYPEDLDYTTMRVFNAMFNVFCVPLAYFTAKELKLNVATVWLV
TSMILFENTYVTLGRFILLDSMLVCFTFTTVYGLARFHNLQREPFSRQWWTTLLLTGISI
GCVTSVKMVGLFATALVGVYTVVDLWIKLGDTKMPYKTYFMHWVARIIGFIILPTLVFMA
AFKAHFIILTKSGPGDSNMSSLFQANLEGTNIVGGPQDLAYGSRFTLKNQGYNGGLLHSH
VQTYPEGSEQQQITTYHHKDANNEWRVETPRDREAYNANTSEIELLKHGDVIRFIHLNTG
RNLHSHQIPAPLTKGDHEVSCYGNLTIGDNKDHWIVEIYDNFGPGDNKVVHPLTTTVRFK
HEVLGCYLSGKGNHLPPWGFKQGEVTCSNKVGKKDKSTHWNFEQHWNERMPDANNTKPPK
TSFIRDFVQLNVAMMASNNALVPDPDKHDELASEAWMWPLNWVGLRLCGWSSTIIKYYLL
GNPVNMWGTTFSLFVFGIMTLVYLIRWQRQIPDFSDAQIEKYMVSGIIPALGWFFHYLPF
IIMGRVKYVHHYLPAFYFATLVFGFVVDHFTSRAPASVKWGVNILFISAVTGMFVLFSPI
SFGMEGEPGAYSYLNWLKGWKI
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgcgactggaatcgatactggtagcgaccagctgaggcaccgaacggggctt
gcagagaagcaggccaacgctctgtccgccacccatcacaatgtcattgagcccgaggac
acaaagacccgaaaggccaccacatcgaccgccgaacagggcaccttctacgagattgag
cgaatcatgggccccatcatcttcaccgccctggctctcttcacccgtctctaccgaatc
ggcgtctctaacattgtcacctgggacgaggctcatttcggcaagtttggttcctactac
ctcaagcgggagtactactttgatgtgcatcctcctcttggaaagatgctggtcggcctg
tccggctacctggcaggctataacggttccttcggttttgagtccggccacacctacccc
gaagatctcgactacaccaccatgcgagtgtttaacgccatgtttaacgtgttctgtgtg
cccctggcttacttcaccgcaaaggagctcaagctcaacgtggccaccgtgtggctcgtc
acctccatgatcctgtttgaaaacacctacgtgactctcggccgattcattctgctggac
tccatgctcgtctgcttcaccttcaccaccgtctacggtcttgcccggttccataacctg
cagcgagagcccttctcccggcagtggtggaccactctgctgctcaccggcatctccatt
ggttgtgtgacttccgtcaagatggtcggtctctttgccactgctctggttggtgtctac
actgtggtcgatctctggatcaagctcggtgacaccaagatgccttacaagacctacttc
atgcactgggttgcccgaatcatcggctttatcatcctgcccactttggtgttcatggct
gctttcaaggcccatttcatcatcctcaccaagtctggacctggcgactccaacatgtct
tctcttttccaggccaacctggagggaaccaacattgtcggcggcccccaggatctcgcc
tacggctctcgattcaccctcaagaaccagggctacaacggaggccttctgcactcccac
gtccagacttaccccgaaggatccgagcagcagcagatcaccacctaccaccacaaggat
gccaacaacgagtggcgagtcgagacccctcgtgaccgagaggcctacaacgccaacacc
tccgaaattgagctgcttaagcacggtgacgttatccgattcatccatctgaataccggc
cgaaacctccactctcaccagatccccgctcctctcaccaagggcgaccacgaggtgtct
tgttacggaaacctgaccattggagacaacaaggaccactggatcgttgagatttatgac
aattttggccctggcgacaacaaggtcgttcaccctctgactaccactgttcgattcaag
cacgaggttcttggctgctacctgtctggcaagggcaaccatctccctccttggggtttc
aagcagggtgaagtcacctgttccaacaaggttggcaagaaggataagtccactcactgg
aactttgagcagcactggaacgagcgaatgcccgatgccaacaacaccaagcctcctaag
acctccttcattcgagactttgttcagctcaacgttgccatgatggcctccaacaacgct
cttgttcccgatcccgataagcacgacgagcttgcctccgaggcctggatgtggcccctc
aactgggtcggtttgcgactctgtggatggagcagcaccatcatcaagtactacctgctt
ggtaaccccgtcaacatgtggggaaccaccttctctctgtttgtgtttggcatcatgact
ctggtctacctgatccgatggcagcgacagattcccgacttctccgacgcccagattgag
aagtacatggtctccggtatcatccccgctctgggatggttcttccactacctgcccttc
atcatcatgggccgtgttaagtacgttcaccactacctgcctgctttctactttgccact
cttgtgtttggctttgtcgttgaccacttcacctctcgagctcccgcctctgtcaagtgg
ggtgtcaacattctcttcatctctgccgtgaccggtatgtttgttctgttctcccccatc
tctttcggtatggagggcgagcccggagcttactcatacctcaactggctcaaggggtgg
aagatttag

DBGET integrated database retrieval system