KEGG   Yarrowia lipolytica: YALI0D02871gHelp
Entry
YALI0D02871g      CDS       T01033                                 

Definition
YALI0D02871p
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
yli  Yarrowia lipolytica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:366219..367640
Genome map
AA seq 473 aa AA seqDB search
MLSVNVKHAGKKYAVEVDPESTGEVFKNQLFSLTGVPPERQKILVKGGQLKDDTLMNSVG
LKEGQTLMLLGSAAAPPKAPEKQAVFLEDMTDAQKAETLQTPPGLVNLGNTCYLNSSLQA
MRTIPELQESLKTSGAAPGSLTNGLNHLYTQMSKTTQPFQPYAFVIQLREHFPQFAEQTQ
GMYKQQDAEEAWSSIFSVLSRDLKDDHVAKYLGGRYETKLVCDEAPDRSPVMGTEDFAKL
HCHISISTNYLVDGLQAGLTETLEKNDEELGRNASFTKTRRITRLPKYLTVQYVRFFWRR
DTQKKSKILRKVIFPINELDVTPLCSDELKAKLIPVRDRVREIGKEKEDARRAAKRAKMN
EEVGATGEVPADEIQQKDKEYAEEIEQLTDSELKNDVGANTSGLYNLQAIVTHQGASADS
GHYQAFVRNEKEPGKWWKFNDDKVTEVDEAKIETLAGGGESDSALILLYKSFE
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgctttctgtcaacgtcaaacacgcgggaaaaaaatacgcggtggaggtggatcccgag
tcgaccggggaggtgttcaagaaccagctgttttcgttgaccggggtgcctccggagcgc
cagaagattctggtcaagggcggacagctaaaagatgacacgttgatgaacagcgtgggg
ctcaaggagggccagacgctgatgcttctcgggtctgccgcggctcctccaaaggcgccc
gagaaacaggctgtgtttctggaggacatgacggacgcgcaaaaggccgaaacgctgcag
actcctccgggtctggtgaatctgggcaacacgtgttatctcaattcgtcgttgcaggcg
atgcggacgattccggagctccaggagtcgttgaaaactagtggagccgcgcccggatcg
ctcaccaacggcctcaaccatctgtacactcagatgagcaagacgacgcagccgttccag
ccctatgcgtttgtgatccagctgcgagaacactttccgcagtttgccgagcagacgcag
ggcatgtacaagcagcaggacgcggaggaagcgtggtcgtcgattttctcggtgctttca
cgtgatctgaaagacgaccatgtggccaagtatctgggaggtcggtatgagaccaagttg
gtgtgcgatgaggccccagaccgatcgccggtaatgggcaccgaggactttgcaaagctg
cattgtcacatttccatctccaccaactatctggtggatggactccaggccgggctgacc
gagactttggagaagaatgacgaggagctggggcgaaatgcgtccttcaccaagacgcgg
cgcattacgcgactgcccaagtatctgactgtgcaatacgtgcgtttcttctggcgacga
gacacccagaaaaagtccaagattctgcgaaaggtgattttccccatcaatgagctcgac
gtgactcctctgtgttcggacgagctcaaggccaagctgattcccgtgcgagatcgggtc
cgggagatcggcaaggagaaggaggatgcccggcgagcagccaaacgggccaagatgaat
gaggaggtgggagctaccggcgaggtgcctgcggacgaaatccagcagaaggacaaggag
tacgccgaggagattgagcagctgaccgactcggagctcaagaacgacgtcggcgccaac
acctcaggtctgtacaacctgcaggccattgtgacccatcagggcgcctcggctgactcg
ggccattaccaggcgtttgtacgaaacgaaaaggagcccggcaagtggtggaagttcaac
gacgacaaggtgaccgaggtcgacgaggccaaaattgagactttggccggaggtggagaa
agcgacagtgcgctgattttgctctacaagagttttgaatga

DBGET integrated database retrieval system