KEGG   Yarrowia lipolytica: YALI0D04026gHelp
Entry
YALI0D04026g      CDS       T01033                                 

Definition
YALI0D04026p
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
yli  Yarrowia lipolytica
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    YALI0D04026g
Enzymes [BR:yli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     YALI0D04026g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:503613..504767
Genome map
AA seq 384 aa AA seqDB search
MASPKGANPVEASKPPVAVAHKQKTTAWRGLMDYLSARQITLPLKVLTYIVVMHRFAALR
PYTRKFFHLQYPKHEVDGVAAYYSRGRDDIYFVLTGILALTFLRAACMDFVLVPMARALK
ITKRKPQLRFAEQGWALIYYTSSTWIGFYLYYHSPYWLNVEELWRGYPHFELDPFFKAYY
LIQFSFWVQQIFVLNMEEKRKDHYQMFTHHIVTCALMCGSYYYYYTRVGHLILVLMDGVD
TLLASAKMLKYLRYDTMCDAMFGLFVIAWVVLRHGLYNYVTWSAYFQAPVLVAENCLRDE
DGQETCFNPALHRVFVVLLIALQIITLIWLYMIVRVIVKILKGGGAEDSRSDDEDSDEEE
GEAEGEEEEEEEEEVMEEKVSDDN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcatctccaaaaggagccaacccggtggaggcttcgaaaccgcccgtggccgtggct
cacaagcagaaaaccaccgcctggcgaggcctgatggactacctgtctgcgcgacaaatc
acgcttccacttaaggtgctgacctacattgtggtgatgcaccgattcgctgccctccga
ccatacacccgcaagtttttccacctgcagtacccaaaacacgaggtggacggcgtggcc
gcctactactcgcgaggccgcgacgacatttactttgtgctcacaggtatcttagctctc
acgtttttgagagctgcctgtatggactttgtactggtgccaatggcccgggctctcaag
atcacaaagcgaaagccgcagctgcggtttgctgagcagggctgggcactcatctactac
acgtcgtccacgtggatcggcttctatctgtactaccactcgccctactggctcaacgtg
gaggagctgtggaggggatacccacactttgagctggaccctttcttcaaggcctactac
ctgatccagttcagcttctgggtgcagcagatctttgtgcttaacatggaggagaagcgt
aaggaccattaccaaatgttcacgcaccacattgtcacctgcgcgctcatgtgcggctcg
tattactactactacacccgcgtgggccacctgattcttgtgctcatggacggcgtggac
acgctgctggcgtcggccaagatgctcaagtacctgcgctacgacacaatgtgcgacgcc
atgtttgggctctttgtcattgcatgggtggtgctccgccacggcctgtacaactacgtc
acgtggtcggcctacttccaggcgccagtcttggtggccgaaaactgtctgcgcgatgaa
gatggccaggaaacgtgtttcaacccggccctccaccgcgtctttgttgtactgctcatt
gccttgcagatcatcaccttgatctggctgtacatgattgtgcgagtcattgtcaagatt
ctcaagggcggaggagcagaggacagtcgatctgacgacgaagacagcgacgaggaagag
ggggaagcagagggggaagaggaagaggaggaagaggaggaggtaatggaggaaaaagtg
tctgacgacaactag

DBGET integrated database retrieval system