KEGG   Yarrowia lipolytica: YALI0D04114gHelp
Entry
YALI0D04114g      CDS       T01033                                 

Definition
YALI0D04114p
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4  [EC:2.7.12.1]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     YALI0D04114g
Protein kinases [BR:yli01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   YALI0D04114g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:513782..517483
Genome map
AA seq 1233 aa AA seqDB search
MSMSMAELSNMDLTDASLFQCDDPDTPKGSIRRQRSRKSLIPRTPSFHSLIVDQEEGQTS
LNQGTQHTAQPTSTTQPTTQHTQHTQHTTQMSLPHQHSPLGMKKSPSGIIATPPIPTNNS
DHATPSYIPQSISSRSLKSILGSTAPTSNTSNNQNLNPLAEKISTYKPKQKLRSVSSGSA
LKPRDSRELREAQLEHERRKTGGLDLAESSKRTPLASLTTKKPRTTVPMSVDPLSGRLKR
VSDVERHRRTASVDKGEEKRVSTSSSHRLSTAERANARSEREREREQERERVRLEREQER
ERVRQERARERAATERAAERVSERASERGAERATERTASDRVASDRASSVRTTTTSDRSE
RITSTRRTQGGATKTIPIQVPSHTRQRSVDRIERAEKETRTSALASALQQRSKPTASASA
GAVGVATSTSAAPIGATSTASVATSTSTTATGNAPISSRTSNVHSTASAPVHMSATARRS
TSHTPLTGPLQTRPKPATEKRFMSHGNEKTKLAPLHIKPLGGGQAQNLVSGPYKYPRVGP
GAPGQGATAAGSPIRPEHRSHSGSPVTNVPGHVSGMSGHMAHPGSAMSGHVSGHVSQSGG
TMTHPGSAMSGNVPGNAMGHVGHVSGHANSGPGNPLGMSMNMGSNTSLNSLHSVHSVHSM
HSMHPPPSMPGSHHGSPRHSPILSMSSSPMNSMPPPGMPPSMGPPRDSSHSPHHFFTPIP
PPHRIGYSLPGSPVRPCPPVAASPDIDCSRSLNSAQSMKTGNRNIPSPSMAANVGASMGA
PNLRGKSYKPMGDASNCSSPLATCFPTRHQVASPVFGVDTVAVAQEMKKLTISKHESPLE
SREKLQASMRTPSTVARLNGKCMTPSEAKARFPLVGFEKTEIASYKHVYYYYPFSNNHES
HSSTTDDSEGNLRLAAGDHIAYRYQVIKLLGKGSFGVVAQCYDHKHGCHVAVKIVKNKKR
FQQQAAVEANFVESLTAKDPDDMHHIVRYRDRVVFRGHLCIVTEMLFLNLYELIGFNKFR
GFSLELVRHFAQQLLNSLAFLGSQNIVHCDLKPENILISDYTKGGIKLIDFGSSCLENEK
VYTYIQSRFYRSPEVILGADYNKAIDMWSFGCIIAELYTGMPIFSGENEQDQLVSIMQVQ
GFPQLRFLSRCSRRRLFFDTMGRPRPSILVSPKGKTRVPNSTSLEHVLGNGTCPSFLSFL
RACLQWDPEDRITAKKALKHEFIVGVGGTQKED
NT seq 3702 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgtccatggcggagttatccaacatggatctaacagatgcctcgctgttccag
tgcgacgaccccgacacacccaagggctcgatacggcgccagcggagtcgcaagtcgctg
attccgcgcacaccatccttccactctctgatagttgatcaagaggagggtcaaacgtcc
ctgaatcagggtacacagcatacggcacaacctacaagtacaacacaaccaacaactcag
catacacaacatacacaacatacaacgcaaatgtctctcccacaccaacactcacctctg
gggatgaagaagagcccgagtggaatcattgccacgccaccgatccccacaaacaactcg
gatcacgccaccccgagttatattccccagagcatctcctcacgcagtctaaagtcgatt
ctgggatctaccgctccgaccagcaacaccagcaacaaccagaacctcaacccgctggcg
gaaaagattagcacttacaaacccaagcagaaactgcgctccgtgtccagcggtagtgcg
ctcaagccacgtgactcacgggagttacgggaggcccaactggagcacgagcggaggaaa
accggcgggctggatctggccgagtcttccaagcgcacaccgctggcgtctctgacgacc
aagaagccccgcacgacggtccccatgagtgtggatccgctgtcgggccggctgaaacgg
gtctctgacgtcgagagacataggagaacggcgtcggtggataagggtgaggagaaaagg
gtatccacgagctcttctcatcgactgtctactgccgaacgggccaatgctcggtcagag
agagaacgggaaagggaacaggagagagagagggtgagattggaaagagagcaggagaga
gagagagtcaggcaggaaagagcgagagagagagcagccaccgagagagcggcagaaagg
gtatccgagagggcttctgaacggggcgctgaacgggccactgagagaactgcttctgat
cgagttgcatctgatagagcttcctcagttcgaactaccaccacgtccgaccgctctgaa
cgaatcacatccaccagacgaactcaaggaggagccaccaaaaccatacccatccaggtg
ccatctcacactcgtcagcggtctgtggatcgaatcgagagagctgagaaggagaccaga
acgagtgctttggccagtgctcttcagcagagatcgaaacccaccgcttccgcgtcggct
ggagcggttggcgtggcaacgtctacgtctgctgcacctattggtgctacttctactgcc
tctgttgctacatccacttctacgacagctacaggaaatgctccaatctcttctcgaaca
tccaatgttcatagcacagcttctgcccctgtccacatgtctgccaccgctcgcagaagc
acctctcacactcctctcactggtcccctccaaacacggcctaagccggccacggaaaaa
cggttcatgagccacggcaacgaaaagactaaactggctcctctgcatatcaagccgctg
ggtggaggacaagctcagaatctcgtctcgggtccctacaagtaccctcgagtgggacct
ggggcgcctggtcagggtgccacagctgcaggcagcccaatcaggccggaacatagaagt
cactccggatctcctgtgaccaatgtacctggtcacgtgagtggaatgtcaggtcacatg
gctcacccggggagtgccatgtcgggtcacgtgagtggtcacgtgtctcaatctggaggg
accatgacacatcctggtagtgccatgtctggtaatgtaccaggaaatgccatgggtcat
gtcggtcacgtgagtggtcatgccaactctggtcccggtaatccccttggcatgtcaatg
aacatgggatccaacacttccttgaactctttgcattcagtccactcggtccactcaatg
cactcgatgcacccacctcccagcatgcccggcagtcaccacggcagtccacgtcattcg
ccaattctcagcatgagttcttcccctatgaactctatgcctcctcctggtatgcctcct
tccatggggccaccacgagactcgtctcattcacctcatcatttctttacacccataccg
cctcctcatcgaattggatactcgcttccaggttctccggtgcgtccatgtcctccagtg
gcagcttccccggacatcgactgttccagaagcctcaattcggctcagagcatgaagaca
ggtaacaggaacatcccgtctcctagcatggctgcaaacgtgggagctagtatgggcgct
cccaacttgcgaggcaagagctacaaacctatgggtgacgcttccaactgctcttctccg
ctggcaacgtgttttcccacccgtcatcaggtagcttctccagtgtttggggtcgacacg
gttgctgtggcccaggaaatgaagaagctgaccatcagcaaacacgagagcccgttggag
tcacgtgaaaagctacaggcatccatgagaactccctcgactgtagcgcgtctcaacggc
aagtgtatgactccctcggaggccaaggcccgtttcccgcttgtggggtttgagaagaca
gaaatcgcgtcctacaaacatgtgtactactactatcccttcagcaacaaccatgagtca
cacagcagtacgacggatgactcggagggcaacctgcggctggcagcaggtgaccacatt
gcctaccgctaccaggtcatcaagttgctgggtaagggttcgtttggtgtggtggcacag
tgctacgaccacaaacacggttgtcacgtggccgtcaagattgtcaagaacaagaaacgg
ttccagcaacaggccgccgtggaggctaactttgtcgagtcgttgactgccaaggacccc
gacgacatgcaccacattgttcgataccgcgaccgggtcgtgttccgaggtcatctgtgc
atcgttacagaaatgctctttctcaatttgtacgagctcattggttttaacaagtttcgg
ggcttttcgttggaactggtgcgacactttgctcagcaacttcttaatagtttggccttc
ctgggctcacagaacattgtccactgcgatcttaaacccgaaaacattctcattagtgac
tacactaaaggtggtatcaagctaattgatttcggctcgtcgtgtctggagaatgaaaag
gtgtacacttacatccagtcgcggttctaccgatcgccggaggtcattctaggtgcggac
tacaacaaggcgattgacatgtggtcgttcggatgcattatcgcagaactgtacactggc
atgccgattttcagcggtgaaaacgagcaggaccagctggtatcgatcatgcaggtccaa
gggttcccacagctgcgcttcctatctcgatgttcgcgaagacggctgtttttcgacacc
atgggccgtccccgaccttccatcttggtttcccccaagggtaagactcgggtgccgaat
tcaacgtccctggagcatgttctgggaaacggtacgtgtccctcgttcctgtctttcctg
cgagcgtgtctgcagtgggaccctgaggatcgaattaccgccaaaaaggcgctcaaacac
gagtttatagttggtgttggaggaacacaaaaggaggattaa

DBGET integrated database retrieval system