KEGG   Yarrowia lipolytica: YALI0D04268gHelp
Entry
YALI0D04268g      CDS       T01033                                 

Definition
YALI0D04268p
Orthology
K00435  
peroxiredoxin [EC:1.11.1.-]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     YALI0D04268g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:complement(533256..534113)
Genome map
AA seq 285 aa AA seqDB search
MAEGDYNAVREAIADILDNDDYDDGSIGPVLVRLAWHASGTYDKATGTGGSNGATMRYMK
EAKDEANNGLENARQFLEPIKAKFPWITYADLWTLAGVVAIEEMDGPKVPWKPGRQDYVD
ETNVPPNGRLPDGAQGQDHLRDIFYRMGFNDQEIVALCGAHNMGRCHMDRSGFEGAWVPN
PIRFANTYFKLLMNEEWKLTTLKNGVKQYFNEDEELMMLPADYSLMQDPEFHKWVEIYAA
DKEKFFEDFSKVFAKLIELGVRRGPDGKAKTNFIDRNNNDPNPRL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggctgagggagactacaacgcagttcgagaggctattgctgacattctcgacaacgac
gactacgacgacggatccattggacccgtgcttgtccgactagcatggcacgcgtcgggc
acctacgacaaggccactggaaccggaggctccaacggtgccaccatgcgatacatgaag
gaggccaaggacgaggccaacaacggtctggagaacgcccgacagttcctcgagcccatc
aaggccaagttcccctggatcacctacgccgatctgtggactctggctggcgttgtggct
atcgaggagatggacggccccaaggtcccctggaagcccggccgacaggactacgtcgac
gagaccaacgttccccctaacggacgactccccgacggagcccagggccaggaccacctt
cgagacatcttctaccgaatgggtttcaacgaccaggagattgtggctctctgcggcgca
cacaacatgggccgatgccacatggaccgatccggttttgagggcgcctgggtgcccaac
cccatccgattcgccaacacctacttcaagctgctgatgaacgaggagtggaagctcacc
actctcaagaacggcgtcaagcagtactttaacgaggacgaggagctcatgatgctgccc
gccgactactcgctcatgcaggaccccgagttccacaagtgggttgagatctacgccgcc
gacaaggaaaagttctttgaggacttctccaaggtcttcgccaagctcattgagctcggt
gttcgacgaggtcccgacggcaaggccaagaccaacttcattgatcgaaacaacaacgat
cctaaccctcgactttag

DBGET integrated database retrieval system