KEGG   Yarrowia lipolytica: YALI0D04422gHelp
Entry
YALI0D04422g      CDS       T01033                                 

Definition
YALI0D04422p
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     YALI0D04422g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:547258..549426
Genome map
AA seq 722 aa AA seqDB search
MALLDSLDFIVLVLVGVATLAFFTKGKLWAKEPETDPYAGGLGSQGFGSTTSFGSFGGNS
NKTRDITKKLEQTGKNVIIFYGSQTGTAEDYANRLSKEATQRYGLKSMTADLEDYDYENL
NSLGDDIVVGFVMATYGEGEPTDNAVNFYEFINDDSSEWAESDEPSADPDSPLSSLNYVI
FGLGNNTYEHYNEIGRNLDKRLKKLGAKRIGDYGEGDDGQGTMEEDYLAWKDDLFSAWKE
AKGLDEHEAKYEPSVKISETGETASSEDSSSVAEPDAEAMSVYLGEPNKKILRGEIKGPY
NAGNPFLANVSETRELFHDPKRSCIHVEFDVGTNVKYTTGDHLALHIQNSDEEVERFLKV
IGLWDKRHNVIKAKPIDPTYKPSFPVPTTYDTVVRYYLEINGAVSRQLLAFIAPFAPTET
AKKEALRLGSDKNAFADEVAKHYTNIAHVLSKLSGGEPWTNVPFSFLVESLPHLIPRYYS
ISSSSLVDKSKISITAVVESLEAPEYAIKGVATNLLLDMKIKKDGVDPSKSKDPQAVHYE
LSGPRGKFGGHKLPVHIRRSNFKLPSDPKKPIIMIGPGTGLAPFRAFVMERAKQAESGTD
VGQQLLFFGCRNPNEDFIYKEQWAGIEKELGDKFTMVTAFSRVDPVQKVYVQHRMQEYAK
QINDLMQQGAYFYVCGDASRMAREVQATLAKILSDQRGIPLSSAEQLVKSLKVQNVYQED
VW
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggctctactcgactctctcgactttattgttctggtgctggtgggcgtggccaccctg
gcctttttcaccaagggcaagttgtgggccaaggagcccgagacggacccctatgcaggt
ggtctgggctcgcagggcttcggatccaccacctcgttcggatcgttcggaggcaactcc
aacaagacccgagacattaccaagaagctggagcagaccggcaagaacgtgatcatcttc
tacggctcgcagaccggaactgccgaggattacgccaaccgactgtccaaggaagcaacc
cagcgatatggcctcaagtccatgaccgccgatctcgaggactacgactacgagaacctc
aactcactgggcgacgacattgtcgtgggttttgtcatggccacttacggcgagggagag
cccaccgataacgctgtcaacttctacgaattcatcaacgacgactcttccgagtgggcc
gaatccgacgagccctctgccgaccccgactctcccctgtcttctctcaactacgtcatt
ttcggtcttggaaacaacacctacgaacactacaacgagattggccgaaacctggacaag
cgactcaagaagctgggcgccaagcgaattggtgactacggcgagggtgacgatggacag
ggcaccatggaagaggactacctcgcctggaaggacgacctcttctccgcctggaaggag
gccaagggtctggacgagcatgaggccaagtatgagccctccgtcaagatctccgagacc
ggcgagaccgcctcttccgaggactcctcttctgttgctgagcctgatgctgaggccatg
tctgtgtacctgggtgagcctaacaagaagattctccgaggcgagatcaagggcccctac
aacgccggtaaccccttcctggctaacgtttccgagacccgagagctgttccacgacccc
aagcgatcctgtatccacgtcgagtttgatgttggcaccaacgtcaagtacaccaccggt
gaccatcttgctctgcacattcagaactccgacgaagaagttgagcgattcctcaaggtc
attggtctctgggacaagcgacacaatgtcatcaaggccaagcccattgatcccacctac
aagccctctttccctgtccctactacctatgatactgttgtccgatactacctggagatc
aacggtgctgtttcccgacagctgctggccttcattgctcctttcgcccccaccgagact
gctaagaaggaagctctgcgacttggttccgacaagaacgcttttgccgatgaggttgcc
aagcactacaccaacattgcccatgttctctccaagctgtctggcggcgagccttggacc
aacgtgcccttctccttcctggttgagtctctcccccatctgatcccccgatactactcc
atctcgtcctcttccttggtggacaagtccaagatctccatcaccgccgtggtcgagtcc
cttgaggcccctgagtacgccatcaagggtgttgccaccaacctgctgcttgacatgaag
atcaagaaggatggtgttgacccctccaagtccaaggacccccaggccgtgcactacgag
ctgagtggtccccgaggcaagtttgggggccacaagctccccgtgcatatccgacgatct
aacttcaagctgccctctgaccccaagaagcccatcattatgattggtccaggaactggt
cttgctcccttccgagcctttgtcatggagcgagctaagcaggccgaaagcggcaccgac
gtgggtcaacagcttctcttctttggctgccgaaaccccaacgaggattttatctacaag
gagcagtgggccggcattgagaaggagctcggtgacaagttcaccatggtcactgctttc
tcccgagtcgaccccgtccaaaaggtctatgtccaacaccgaatgcaggaatatgccaag
cagatcaacgatctcatgcaacagggcgcctacttttacgtgtgtggagacgcctcgcga
atggcccgagaggttcaggccaccctggccaagattctgtctgatcagcggggcattccc
ctgtcttctgctgagcagctggtcaagagcctcaaggtgcagaacgtctaccaggaagat
gtgtggtag

DBGET integrated database retrieval system