KEGG   Yarrowia lipolytica: YALI0D06215gHelp
Entry
YALI0D06215g      CDS       T01033                                 

Definition
YALI0D06215p
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
yli  Yarrowia lipolytica
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YALI0D06215g
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YALI0D06215g
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YALI0D06215g
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YALI0D06215g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     YALI0D06215g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:complement(796423..797844)
Genome map
AA seq 473 aa AA seqDB search
MLRTLARTRMPLRAQINTRFMSQTTAAAEESPVLFSDNGTTRTITLNRPKKLNALDDPMC
RAIFPRLKEWLKSDSANVVLFKGSGNKAFCAGGDVATLAKQNAAGAQGIEQSRDFFCTEY
AMDFLLSVYPKPVIALNHGITMGGGLGVSMHLPFRVATETTLSAMPETSIGFFCDVGGTF
FLPRLDGELGTFLALTSSRLKGYEAVAAGFATHYIPSARLDDLEKAIASLDIPKGRDATE
LYSQLNALLNDYSEVPANFKFQYGGEFRALIDRTFKYDAIEDIVAALKQEGEAGEKIIKL
LGERSPTSVKVTLAALRRGRNQDIQSVFNDECNYAENFMHSREFIEGVTAKLIDKPAREP
QWEPSSFEGVTPEIVKSFIQKRPGSKNDEMEVVINDTYKQYPWNFGLPREVEIEQYIKGE
TRSSDYKASPAEVVNHFTNKYSGKPGVSEKVKEVMQRKTKPDPNEPKVLDWVN
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgaacactagcccgaactagaatgcccctgcgagctcaaatcaacacccgattc
atgtcacagaccacggcggctgccgaggagtcgcctgtactcttcagcgacaacggcacc
acccggaccatcaccctcaaccggcccaagaaactcaacgctctggacgaccccatgtgc
cgagccatcttcccccgcctcaaggagtggctcaaatccgactccgccaatgtcgtgctg
ttcaagggctccggcaacaaggctttctgtgccggaggtgacgtggctactcttgccaag
cagaacgctgcaggcgcccagggcattgagcaatccagagacttcttctgcacggaatac
gccatggacttcctgctatccgtctaccccaagcccgtgattgcgctcaaccatggcatc
accatgggtggaggtctgggtgtctccatgcaccttcccttccgagtggccactgaaacc
accctctcggccatgcccgagacctcaattggtttcttctgcgacgttggcggcaccttt
ttcctgccccgactcgacggagagcttggaaccttcctggctctgacctcgtcccgactc
aagggctacgaggctgtggctgccggcttcgccacccactacatcccctccgctcgacta
gacgatctggagaaggccatcgcttctctggacatccccaagggccgagacgccaccgag
ctgtactcccagctcaacgcactgctcaacgactactcggaggtgcctgccaacttcaag
ttccagtacggcggcgagttccgagctctgatcgaccgaaccttcaagtacgacgccatt
gaggacattgtggcagctctgaagcaggagggtgaggctggtgagaagatcatcaagctc
ctgggcgagcgatcccctacctctgtcaaggtgactcttgccgctctgcgacgaggccga
aaccaggacattcagtccgtgttcaacgatgagtgcaattacgccgagaactttatgcac
tctcgagagttcattgaaggtgtcaccgccaagctcattgacaagcctgcccgagagccc
cagtgggagccttcttctttcgagggcgtgactcccgagattgtcaagtcgtttatccag
aagcgacccggctccaagaacgacgagatggaggtggtcatcaacgatacctacaagcag
tacccctggaactttggcttgccccgagaggtggaaattgagcagtacatcaagggcgag
acccgatcgtcggattacaaggcttcccctgccgaggttgtcaaccactttactaacaag
tactctggtaagcctggtgtgagcgagaaggtcaaggaggtgatgcagcgaaagaccaag
cctgatcctaacgagcccaaggttcttgactgggttaactag

DBGET integrated database retrieval system