KEGG   Yarrowia lipolytica: YALI0D07084gHelp
Entry
YALI0D07084g      CDS       T01033                                 

Definition
YALI0D07084p
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
yli  Yarrowia lipolytica
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YALI0D07084g
Enzymes [BR:yli01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     YALI0D07084g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:complement(904407..905270)
Genome map
AA seq 287 aa AA seqDB search
MSVSQTDSTVTVTIGSSEVKILRYGATVLSWTIDGKEQLWLSESAKLDGSKAVRGGIPLV
FPVFGKSTEGPTSALPQHGFARTSTWEYLGQTSEKPVAAIQFGLGPENLSDEAKKQWDYN
FTLIYTVTIDDANKTLETRMSVENAEQNKPFDFNILFHTYLRVPEIANVEVTGLQAVPVK
DKVTVSSYVEQAAKVTVSGEVDRVYENVPGAVNVDVENKPYLTVTRDNINDVVVWNPWTE
KAEGLADFTPKQGFHHMICIEAGDVAKWQKLAAGDKWEGGQKIKAHL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgtcccaaaccgattctaccgtgactgtcactatcggctcgtccgaagtcaag
atcctacgatacggagccaccgtcctatcgtggaccattgacggcaaggaacagctgtgg
ctgtccgagtctgccaagctcgatggctccaaggccgtgcgaggaggcattcctcttgtt
ttccccgtttttggcaagtccaccgagggccccacttcggcccttccccagcatggcttt
gcacgaacctccacctgggagtaccttggtcagacttcggagaagcccgtggctgccatc
cagtttggtctgggtcctgagaacctgtctgacgaggccaagaagcagtgggactacaac
ttcactctgatttacaccgtgactatcgacgacgccaacaagactctcgagacccgaatg
tcagtggagaacgctgagcagaacaagcccttcgacttcaacatcctcttccacacctat
ctgcgagtccccgagattgccaacgtcgaagtgactggtctgcaggccgtccccgtcaag
gataaggtgactgtttcttcctacgtcgagcaggccgccaaggtgactgtatccggagag
gtcgatcgagtgtacgaaaatgtgcctggagctgtcaatgtcgatgtcgagaacaaaccc
tacctaaccgtcactcgagacaatatcaacgacgtggtggtgtggaacccctggaccgag
aaggccgagggtctcgctgatttcacccccaagcagggcttccaccatatgatctgcatc
gaggcaggagacgtggccaagtggcagaagctggccgctggcgataagtgggagggtggc
cagaagatcaaggctcatttgtag

DBGET integrated database retrieval system