KEGG   Yarrowia lipolytica: YALI0D07084gHelp
Entry
YALI0D07084g      CDS       T01033                                 

Definition
YALI0D07084p
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
yli  Yarrowia lipolytica
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:yli00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:complement(904407..905270)
Genome map
AA seq 287 aa AA seqDB search
MSVSQTDSTVTVTIGSSEVKILRYGATVLSWTIDGKEQLWLSESAKLDGSKAVRGGIPLV
FPVFGKSTEGPTSALPQHGFARTSTWEYLGQTSEKPVAAIQFGLGPENLSDEAKKQWDYN
FTLIYTVTIDDANKTLETRMSVENAEQNKPFDFNILFHTYLRVPEIANVEVTGLQAVPVK
DKVTVSSYVEQAAKVTVSGEVDRVYENVPGAVNVDVENKPYLTVTRDNINDVVVWNPWTE
KAEGLADFTPKQGFHHMICIEAGDVAKWQKLAAGDKWEGGQKIKAHL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgtcccaaaccgattctaccgtgactgtcactatcggctcgtccgaagtcaag
atcctacgatacggagccaccgtcctatcgtggaccattgacggcaaggaacagctgtgg
ctgtccgagtctgccaagctcgatggctccaaggccgtgcgaggaggcattcctcttgtt
ttccccgtttttggcaagtccaccgagggccccacttcggcccttccccagcatggcttt
gcacgaacctccacctgggagtaccttggtcagacttcggagaagcccgtggctgccatc
cagtttggtctgggtcctgagaacctgtctgacgaggccaagaagcagtgggactacaac
ttcactctgatttacaccgtgactatcgacgacgccaacaagactctcgagacccgaatg
tcagtggagaacgctgagcagaacaagcccttcgacttcaacatcctcttccacacctat
ctgcgagtccccgagattgccaacgtcgaagtgactggtctgcaggccgtccccgtcaag
gataaggtgactgtttcttcctacgtcgagcaggccgccaaggtgactgtatccggagag
gtcgatcgagtgtacgaaaatgtgcctggagctgtcaatgtcgatgtcgagaacaaaccc
tacctaaccgtcactcgagacaatatcaacgacgtggtggtgtggaacccctggaccgag
aaggccgagggtctcgctgatttcacccccaagcagggcttccaccatatgatctgcatc
gaggcaggagacgtggccaagtggcagaagctggccgctggcgataagtgggagggtggc
cagaagatcaaggctcatttgtag

DBGET integrated database retrieval system