KEGG   Yarrowia lipolytica: YALI0D09273gHelp
Entry
YALI0D09273g      CDS       T01033                                 

Definition
YALI0D09273p
Orthology
K08738  
cytochrome c
Organism
yli  Yarrowia lipolytica
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    YALI0D09273g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:1176675..1176998
Genome map
AA seq 107 aa AA seqDB search
MGYKEGSAKKGATLFKTRCAQCHTTEAGGPHKVGPNLHGVINRHSGEAEGYSYSDANKRK
GIEWTTEHLFEYLENPKKYIPGTKMAFGGLKKPKDRNDLITWMVENC
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggttacaaggaaggttccgctaagaagggtgctactctcttcaagactcgatgcgct
cagtgccacaccaccgaggccggaggaccccacaaggtcggccccaacctccatggtgtc
atcaaccgacactccggagaggccgagggctactcttactccgatgccaacaagcgaaag
ggtattgagtggaccaccgagcatctgtttgagtacctcgagaaccccaagaagtacatt
cccggtaccaagatggctttcggaggtctcaagaagcccaaggaccgaaacgatctgatc
acctggatggtcgagaactgctaa

DBGET integrated database retrieval system