KEGG   Yarrowia lipolytica: YALI0D11110gHelp
Entry
YALI0D11110g      CDS       T01033                                 

Definition
(RefSeq) YALI0D11110p
  KO
K01656  anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
yli  Yarrowia lipolytica
Pathway
yli00400  Phenylalanine, tyrosine and tryptophan biosynthesis
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
yli01130  Biosynthesis of antibiotics
yli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YALI0D11110g
Enzymes [BR:yli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     YALI0D11110g
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     YALI0D11110g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS GATase Peptidase_C26 His_biosynth QRPTase_C
Motif
Other DBs
NCBI-GeneID: 2910726
NCBI-ProteinID: XP_502685
UniProt: Q6C9H7
Position
D:complement(1394566..1395993)
Genome map
AA seq 475 aa AA seqDB search
MASKTKVLLIDNYDSFTWNIYEYLCQEGADVEVFRNDKITVEEIEAKNPDIIFISPGPGH
PKTDAGVSIDTIHYFKGKKPIVGVCMGQQCMYEAFGGTVGFAGEIVHGKSSPVKHDGKGL
FDNIAQDVEVTRYHSLAGTRESLPECLEITAETHNGVIMGVRHKEYVIEGVQFHPEGILT
DDGRTMISNVLKFRGGTWADKKSSEDKTPAQTSILQRIYAQRKADVDAQKKIPGQSFEDL
QKSLPYAPKLIDVKQRLLQKTPAMMAEIKRASPSKGPIDLQAHAPTQALIYANAGASAIS
VLTEPHWFKGSLEDMRLVRLAVDSLENRPAILRKEFIFDRYQILEARLNGADTVLLIVKM
LDDELLADLYKYSKSLGMEPLVEVASLPEMERANRLNAQLIGVNNRDLHSFNVDLNTTSS
VMSLASEDIVIAALSGITCKADVEKYVSEGVKAVLVGEALMRAKDTSAFVKELIG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaagaccaaagttcttctgatcgacaactacgactccttcacctggaacatc
tacgagtacctgtgccaggagggagccgacgtggaggtttttcgaaacgacaagatcacc
gtggaggagatcgaggctaagaaccccgacatcatcttcatttccccgggcccaggacac
cccaagaccgatgctggagtgtctatcgataccattcattatttcaagggcaagaagccc
attgttggagtctgtatgggccagcagtgcatgtacgaggcctttgggggcactgtgggc
tttgctggagagattgtccatggtaagtcttctcccgtcaagcatgacggcaagggcctg
tttgacaacattgcccaggatgtggaggtgactcgatatcactctcttgccggtactcga
gagtctctgcccgagtgtctggagatcactgctgagacccacaatggagttatcatggga
gtgcgacacaaggagtatgtcattgagggagtgcagttccaccccgagggcattctgaca
gatgacggccgaaccatgatctccaacgtgctcaagtttcgaggaggaacctgggccgat
aagaagtcttccgaggataagacccctgcccagacctctattctgcagcgaatctacgcc
cagcgaaaggccgacgtcgacgcccagaaaaagatccccggccagtcgtttgaggatctg
cagaagtcgctgccctacgctcccaagctcatcgatgtcaagcagcgtcttctccagaag
actcctgccatgatggccgagatcaagcgagcttctccctccaagggccctatcgatctg
caggctcatgctcccacccaggctctcatctacgccaacgctggcgcttctgccatctct
gtcctcactgagcctcactggttcaagggctcgctggaagacatgcgcctggttcgtctg
gccgtggactctctggagaaccgacctgccattctgcgaaaggagttcatcttcgaccgg
taccagattcttgaggcccgactcaatggagccgacaccgtgctgctcattgtcaagatg
ctggacgacgagctgctggcagacctctacaagtactccaagtctctgggcatggagccg
ttggtggaggttgcttctctgcccgagatggagcgtgcaaacaggctcaacgctcagctc
attggtgttaacaaccgagacctgcattcgttcaacgtggacctcaacaccacttcttca
gtcatgagcctagcctcggaggatattgtgattgctgcgctcagtggcatcacgtgcaag
gccgacgtggaaaagtacgtttccgagggtgtcaaggctgttcttgtcggcgaggctctc
atgcgagccaaggacacttcggcttttgtcaaggagctcattggttag

DBGET integrated database retrieval system