KEGG   Yarrowia lipolytica: YALI0D11330gHelp
Entry
YALI0D11330g      CDS       T01033                                 

Definition
YALI0D11330p
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
yli  Yarrowia lipolytica
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:yli00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:join(1420015..1420023,1420335..1421201)
Genome map
AA seq 291 aa AA seqDB search
MLVPWAPIAATSVVAAAASSYYFSNMAISNDAKTATLKGDDQWVDLKLKSSKDLSHNTKA
LIFELPTPDSTLGLTTASALLTKYVTPKGSNVVRPYTPVSDPDSKGEFELVVKSYPEGKM
SKHIHELKEGDTLSFKGPIIKYQWQPNLHKEITLIGAGTGITPLYQLISAINKNPEDKTK
VNLFYGNATEGDILLKDEIDAIAKAKPQQFNVHYFLDKPSDNWKGENGFISEEFIKGNSP
AADSDNVKVFVCGPPPFYKAISGAKVSPTDQGEVDGALKNLGFNKDQVFKF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtgccctgggcccccattgctgccacctctgtagttgccgccgccgcctcttcc
tactacttctccaacatggccatctccaacgacgctaagaccgccaccctcaagggcgac
gaccagtgggttgatctcaagctcaagtcctccaaggacctgtcccacaacaccaaggcc
ctcatcttcgagctccctacccccgactccaccctcggtcttaccaccgcttccgctctc
ctcaccaagtacgtgacccctaagggctccaacgttgtccgaccttacacccctgtttcc
gaccctgactccaagggcgagtttgagctcgtcgtcaagtcctaccccgagggtaagatg
tccaagcacatccacgagctcaaggagggtgacactctgtccttcaagggtcccatcatc
aagtatcagtggcagcccaacctccacaaggagatcaccctgattggtgccggaaccggc
atcacccctctgtaccagctcatctctgccatcaacaagaaccccgaggataagaccaag
gtgaacctcttttacggtaacgccactgagggtgacattctcctcaaggacgagattgac
gccatcgccaaggccaagccccagcagttcaacgtccactacttcctcgacaagccttcc
gacaactggaagggtgagaacggatttatctccgaggagttcatcaagggcaactccccc
gctgccgactccgacaacgtcaaggtctttgtctgcggtcctcctcctttctacaaggcc
atctccggcgccaaggtctctcctaccgaccagggcgaggttgacggtgctctcaagaac
ctcggtttcaacaaggaccaggtcttcaagttctaa

DBGET integrated database retrieval system