KEGG   Yarrowia lipolytica: YALI0D11330gHelp
Entry
YALI0D11330g      CDS       T01033                                 

Definition
YALI0D11330p
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
yli  Yarrowia lipolytica
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YALI0D11330g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     YALI0D11330g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:join(1420015..1420023,1420335..1421201)
Genome map
AA seq 291 aa AA seqDB search
MLVPWAPIAATSVVAAAASSYYFSNMAISNDAKTATLKGDDQWVDLKLKSSKDLSHNTKA
LIFELPTPDSTLGLTTASALLTKYVTPKGSNVVRPYTPVSDPDSKGEFELVVKSYPEGKM
SKHIHELKEGDTLSFKGPIIKYQWQPNLHKEITLIGAGTGITPLYQLISAINKNPEDKTK
VNLFYGNATEGDILLKDEIDAIAKAKPQQFNVHYFLDKPSDNWKGENGFISEEFIKGNSP
AADSDNVKVFVCGPPPFYKAISGAKVSPTDQGEVDGALKNLGFNKDQVFKF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtgccctgggcccccattgctgccacctctgtagttgccgccgccgcctcttcc
tactacttctccaacatggccatctccaacgacgctaagaccgccaccctcaagggcgac
gaccagtgggttgatctcaagctcaagtcctccaaggacctgtcccacaacaccaaggcc
ctcatcttcgagctccctacccccgactccaccctcggtcttaccaccgcttccgctctc
ctcaccaagtacgtgacccctaagggctccaacgttgtccgaccttacacccctgtttcc
gaccctgactccaagggcgagtttgagctcgtcgtcaagtcctaccccgagggtaagatg
tccaagcacatccacgagctcaaggagggtgacactctgtccttcaagggtcccatcatc
aagtatcagtggcagcccaacctccacaaggagatcaccctgattggtgccggaaccggc
atcacccctctgtaccagctcatctctgccatcaacaagaaccccgaggataagaccaag
gtgaacctcttttacggtaacgccactgagggtgacattctcctcaaggacgagattgac
gccatcgccaaggccaagccccagcagttcaacgtccactacttcctcgacaagccttcc
gacaactggaagggtgagaacggatttatctccgaggagttcatcaagggcaactccccc
gctgccgactccgacaacgtcaaggtctttgtctgcggtcctcctcctttctacaaggcc
atctccggcgccaaggtctctcctaccgaccagggcgaggttgacggtgctctcaagaac
ctcggtttcaacaaggaccaggtcttcaagttctaa

DBGET integrated database retrieval system