KEGG   Yarrowia lipolytica: YALI0D16335gHelp
Entry
YALI0D16335g      CDS       T01033                                 

Definition
YALI0D16335p
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     YALI0D16335g
Peptidases [BR:yli01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   YALI0D16335g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:complement(2018592..2022074)
Genome map
AA seq 1160 aa AA seqDB search
MVDDDFGVKSLDSSDNSPAESAHDTHAETEHDKTSTSETESVPEVATDIDMLKSKMHSTM
FDDEAETDSEFDFTWEISDWTALPKRVHSDPFVHNGVRYRLLLFPQGKSQGEVSLFLEAA
PDVSDGARVDPDWAVCVQFSLVMWNPNAPYIFQNMVAHHRFDAEDGGDWGFSRFYDLRRL
AARHLDTQHALLERNVMNITVVGRVFKDPTGVLWHNFLRYDSKRVTGYVGLRNQGATCYL
NSLLQSLYFTNAFRKAVFGIPTGENDAASAKVPHALQRLFYQLQTSDEPVSTLELTRAFG
WDSADAFTQHDVQELERVLMDSLEGSMKGTKVDGALSELFVGQMKSFIRCIDVDYESSRS
EDFWDVQLNVKGMQGLETSLRNYIEVEMLDGENQYMAEGYGLQDAQKGVSFQSFPPVLHL
QLKRYEYDFERDSMTKINERYEFPPSVNLAPYLDRAADMSESWEYELHAVLVHSGDLNTG
HYYGLLKPERDSPWFKFDDDRVTRATNKEVFEDNFGGDGLHNQHNKPLSARQQRNMRYKR
QTSAYMLVYIRKSRLEQVLGKVHDSDVPAHIPQELSQEAAVEERRRQEMEEQHLYMPVSV
ASLSQFQSHHGFDTAIWSGTSLDDADHAGVPVSVRALKTWTLAELQAAIAQQLGLDDSAQ
IRLRGCVKRKNGTIRPDAIIVSQSPDETLEQIRDRVSTRTPELRVYVEQISSDTPAPMPT
QSIVFLKHFDVETQTLVGVGHVLVDSSDTVGSIVPYITQSMGWDAATPVVLFEEIKPRMI
DIVKQDKTFDEAEIQNGDIITFQRNDVAPAGRVRCQDPQQYYDFLYSRLRVNFVSRQDPE
DEDSCVSLWLSKKDSYDDVAAAVGDVLGHPGSHIRLYVTNSDGSPRASIKSNSGSLSAII
STNYVSSHNPLLAYDILDMPLVELETKRNVQVVFLRNGLSTDEKYSFLLPETGHVGDIVT
SLKAQAKGLENVPPEAFKLWFFNNGRNTQYFSLHESLKRFPDDTTLHAAVMTPEEQAVVK
HEEQVASHVPQVDTVDENGTVVMAPTPEIPACPYKWVHCFHFWKDPMRPHSIPFSFAAAQ
GELWPDTKLRLKQVTGYSDQVFDKIKFAIVRDDSYAEPHYFGDEDELYAMVGDNLLLGLD
HVDKTPYKKGYGERAIFINK
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atggtggatgatgatttcggagtcaagtcgctggactcgtcggacaattcgcccgccgag
tctgcccacgacacccacgccgaaactgaacacgacaagacaagcacctccgaaacggag
tctgtgcccgaggtggccacagacattgacatgctcaagtccaagatgcactcgacaatg
ttcgacgacgaggccgagaccgacagcgagttcgacttcacgtgggaaatctcagactgg
accgcgctgcccaaacgggtgcactcagacccgtttgtgcacaacggcgtgcgctaccgg
ctgctgctgttcccgcagggcaagagccagggtgaggtctcgctgtttctggaggccgcg
cccgacgtgagcgacggagcgcgtgtggatcccgactgggccgtttgtgtccaattcagc
ctggtcatgtggaaccccaacgccccctacattttccagaacatggtggcgcatcaccgg
ttcgacgccgaagacggaggcgactggggcttctcgcggttctacgaccttcgacgactc
gccgcccgccacctcgacacccaacacgcgctgctggaacgcaacgtgatgaacatcacc
gtggtgggcagggtattcaaggatcccaccggcgttctgtggcataactttctgcgctac
gactccaagcgtgtcaccggctatgttggcctgcgaaaccagggcgccacctgctatctc
aactccctgctgcagtcgctctacttcaccaacgccttccgtaaagcggtatttggtatc
cccaccggcgagaacgacgccgccagcgccaaggtgcctcatgctctccagcggctgttc
taccagctacagacgtctgacgagcctgtctccacactggagctcacccgggctttcggc
tgggattctgcagacgcattcacacagcacgacgtgcaggagctggagcgggtgctgatg
gactcgctggagggatctatgaagggcaccaaggtggacggtgcgctgtcagagctgttt
gtcggccagatgaagtcgttcatccggtgcatcgatgtggattacgaatcgtcgcgatcc
gaggacttttgggacgttcagctcaacgtgaagggcatgcagggcctcgaaacgtcgctg
cgcaactacattgaggttgagatgctcgacggcgaaaaccagtacatggctgagggctat
gggctgcaggacgctcagaagggtgtctcgttccagtcgttccccccagttctgcatctg
cagctgaagcggtatgagtacgactttgagcgcgactccatgaccaagatcaacgagcga
tatgagttccccccctcggtgaacctggcaccctatcttgatcgtgccgctgacatgtcc
gagtcgtgggaatacgagctgcatgccgtgctcgtgcacagtggcgatctcaacacgggt
cactactatggactactcaaacctgagcgggactctccctggttcaagtttgacgacgac
cgtgtaacacgggccaccaacaaggaggtgtttgaggacaactttggtggcgacgggctt
cacaaccagcacaacaagccgctgtcggcccgacagcagcgcaacatgcggtacaagcgc
cagacgtcggcgtacatgctggtttacatccgaaagagccgtttggaacaggtgcttggc
aaggtgcacgactcggacgtgccggctcatatcccgcaggagttgagccaagaggcagcc
gtggaggagcggcgacgtcaggagatggaagaacagcacctgtacatgcccgtcagtgtt
gcttccttgtctcaattccagagccaccacggtttcgacactgcgatctggtctggcacg
tccctggacgatgctgaccacgccggagtgcctgtgtctgtgcgtgctctcaaaacctgg
actctggcggagctccaggcagccatcgcccaacaactgggactggatgactctgcgcag
attcggctcagaggctgtgtgaagcgaaagaacggaaccatccggccagacgccatcatc
gtctctcagtcacccgacgagacgcttgagcagattcgagacagggtatctactcgaacc
ccggagcttcgagtgtacgtggagcagatctccagcgacactcctgcccccatgcctacg
cagagcattgtttttctgaagcatttcgatgtggagacccagactctggtgggcgtgggt
catgtgctggtagactccagcgatacggtgggctccatcgtgccctacatcacccagtcc
atgggctgggatgccgctacgcccgtcgtactctttgaggagatcaagcctcgaatgatc
gacattgtcaaacaggacaagacgtttgacgaggccgagatccagaacggagacattatc
accttccaacgaaacgatgtggctcctgccggtcgagtgcgatgccaggacccccagcag
tactacgacttcctctacagccgactacgggtcaactttgtgtctcgccaggaccccgag
gatgaggattcatgcgtgtcgttgtggctgtcaaagaaggactcctatgacgatgttgcg
gctgctgtgggtgatgttcttggccatcccggctcccacatccgtctgtatgtgactaac
agcgacggctctcctcgagcaagcatcaagagcaactctggctctctctcggccatcata
tcgaccaactacgtctcctcgcacaaccctctacttgcgtacgacattctggacatgcct
ctggtggagctggagacaaagcggaacgtgcaggttgtttttttgcgtaacgggctcagc
acggacgaaaaatactcgttcctgctgccggaaactggccatgtgggcgatattgtgaca
tctctcaaggcccaggccaaggggctggagaatgtgcctcccgaagcgttcaagctatgg
tttttcaacaacggtcgaaacactcagtacttcagtctgcatgagtctctgaagcggttt
cccgacgacaccacgctccatgcagccgttatgactcccgaggagcaggctgttgtgaag
cacgaggaacaggtggctagccacgtcccgcaggtggacactgtggacgaaaatggtact
gttgtcatggctcccactcccgagatcccagcttgtccctacaagtgggttcattgcttc
catttctggaaggatcctatgcgaccccattccattcctttttcgtttgcggctgcccaa
ggcgagctgtggcccgataccaagctgcggctcaagcaggtgactggttactccgatcag
gtgtttgacaagatcaagtttgcaattgtgagggacgattcgtacgccgagccccactac
tttggcgatgaggacgagttgtatgccatggttggcgacaacttgttgctgggtttggat
catgtggacaagacgccatacaagaagggctacggtgaacgggctattttcatcaacaag
tga

DBGET integrated database retrieval system