KEGG   Yarrowia lipolytica: YALI0D16357gHelp
Entry
YALI0D16357g      CDS       T01033                                 

Definition
YALI0D16357p
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
yli  Yarrowia lipolytica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:yli01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:yli01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:yli00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:yli00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:yli00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:yli00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:yli00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:2024128..2026989
Genome map
AA seq 953 aa AA seqDB search
MIEGISFASFVTHEKPKFVRALDFYKALGFLPTKEYKHGTDHHATDEEGAGSIQEVWLTS
SRAGVPSVTVKLRLSRHGNEHVSLPNLKHDWRSLVPSLVYYAPDLDAVRAAITPFLHEDH
STLLERPSHTNFIELYAIDPMGNLVGFSRRENPYSSAMQKPFSADDIGPQNFSKPNETKI
KGKKRIGVMTSGGDAPGMCAAVRAVVRAGIARGCEVYAVREGYEGLVKGGDLIEPLSWED
VRGWLSLGGTLIGTARCKEFREREGRLAGALNMVKNGIDALIVIGGDGSLTGADLFREEW
PSLIEELVTNGSITAEQAERHRHLDICGMVGSIDNDMATTDVTIGAYSSLDRICELVDFI
DATAQSHSRAFVVEVMGRHCGWLALMAGTATGADYIFIPEAAPDATQWAEKMTRVVKRHR
SQGKRKTVVIVAEGAIDSDLNPITAKMVKDVLDGIGLDTRISTLGHVQRGGPPVAADRVL
ASLQGVEAIDAILSLTPETPSPMIALNENKITRKPLVESVALTKKVADAIGNKDFAEAMR
LRNPEFVEQLQGFLLTNSADKDRPQEPAKDPLRVAIVCTGAPAGGMNAAIRSAVLYGLAR
GHQMFAIHNGWSGLVKNGDDAVRELTWLEVEPLCQKGGCEIGTNRSLPECDLGMIAYHFQ
RQRFDGLIVIGGFEAFRALNQLDDARHAYPALRIPMVGIPATISNNVPGTDYSLGADTCL
NSLVQYCDVLKTSASATRLRLFVVEVQGGNSGYIATVAGLITGAYVVYTPESGINLRLLQ
HDISYLKDTFAHQADVNRTGKLLLRNERSSNVFTTDVITGIINEEAKGSFDARTAIPGHV
QQGGHPSPTDRVRAQRFAIKAVQFIEEHHGSKNNADHCVILGVRGSKFKYTSVSHLYAHK
TEHGARRPKHSYWHAIGDIANMLVGRKAPPLPETLNDEIEKNIAKEQGIIDPC
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaggaatctcctttgcgtcgtttgtgacacacgaaaaacccaagtttgtgcgc
gccctggacttctacaaggccctgggcttcctccccaccaaggagtacaagcacggaaca
gaccaccatgccaccgacgaagaaggcgcgggctcgatccaggaggtctggctcacgtcg
tcgcgagccggtgtgccgtctgtgaccgtcaaattgcgactctcccgccacggaaacgaa
cacgtgtctctccccaacctcaaacacgactggcggtcgctggtgccctcgctggtgtac
tacgcccccgacctggacgcggtgcgagccgcaatcaccccgttcttacacgaggaccac
tccacgcttctggaacgcccttcccacacaaacttcatcgagctgtacgccattgacccc
atgggaaacctcgtgggcttttcccgacgagaaaacccttactcgtcagcgatgcagaaa
cccttctctgctgacgacattggcccgcagaacttctcaaagcccaatgaaaccaaaatc
aagggcaagaagcgtatcggtgtcatgacctccggaggagacgcccccggcatgtgtgcg
gccgtgcgagctgtggtccgagccggaattgcccgcggctgcgaggtctacgctgtccga
gagggctatgagggtcttgtcaagggtggcgacctcattgagcccctgtcatgggaagac
gtacggggctggctctccctgggaggaacccttattggaactgctcgatgcaaggagttc
cgagaacgagagggccgactggcaggagccctcaacatggtcaagaacggcattgacgcg
ctcattgtcattggcggagacggctcgttgaccggagccgatctgttccgagaagaatgg
ccgtctctaatcgaggagctagtcaccaatggctccatcaccgccgagcaggccgaacga
caccgacacctcgacatttgcggtatggtaggctccatcgacaacgacatggctaccacc
gacgtcaccattggtgcttactcatcgctcgaccgaatctgcgagctggtagacttcatc
gatgccaccgcccagtcgcactcgcgagcctttgtcgtcgaggttatgggtcggcactgt
ggctggctggctctcatggccggcactgctaccggcgccgactacatttttatccccgag
gctgctcccgatgctactcagtgggccgagaagatgacccgtgtcgtcaagagacaccga
agccagggcaagcgaaagaccgtggtcattgtcgccgagggcgcaatcgactcggacctc
aaccccatcactgccaagatggtcaaggatgtgctagacggcattggactcgatactcga
atctccaccctgggtcacgtacagcgaggaggtcccccagttgccgctgatagagttctg
gcttcactgcagggtgtggaggctatcgacgccatcctgtctctcaccccagagacgccc
agtcccatgattgctctcaacgagaacaaaatcacccgcaagccgctcgtggagtctgta
gctctcaccaagaaggttgccgatgccattggcaacaaggactttgccgaggccatgcgg
cttcgaaaccccgagtttgtggagcaattgcagggtttcctgctcacaaactctgctgac
aaggaccggccccaggagcctgccaaggatcccctgcgagtcgccattgtgtgcactggc
gctcctgctggcggaatgaacgctgccatccgatctgctgttctgtacggtcttgctcga
ggccaccaaatgtttgccatccacaatggatggtccggcctcgtcaagaatggtgacgac
gcggtgcgggagctgacttggctcgaggtcgagcccctgtgtcagaagggtggctgtgag
attggtactaaccgatctctgcccgaatgtgatcttggaatgattgcataccactttcag
cgacaacggtttgacggtctaatcgtcattggtggttttgaggctttccgagcgctgaat
cagctcgacgatgcccgtcacgcctaccctgctcttcgaatccccatggttggtattcct
gccaccatttcgaacaacgtgcctggaacggactattctcttggagccgacacttgtctc
aactctctggttcagtactgcgacgtgctcaagacgtctgcttctgccactcgtctgcgt
ctgtttgtggtcgaggtgcagggtggaaactctggttacatcgccaccgtggctggtttg
atcaccggcgcctatgtggtgtacacacccgagagcggtatcaacctgcgacttcttcag
cacgacatttcctaccttaaggatacttttgctcatcaggcggacgtgaaccgaaccgga
aagctgcttctgcgaaacgagcggtcatccaacgtgttcaccactgatgtcatcaccggc
atcatcaacgaggaggccaagggttcatttgacgcgcgaaccgccatccctggccatgtg
cagcagggaggacacccctctcctaccgatcgagtgcgtgctcagcgatttgccatcaag
gccgtgcagtttattgaagagcaccacggctccaaaaacaatgccgatcactgtgtgatt
ctcggtgtgcggggctccaagttcaagtacacctctgtgtcgcatctgtacgcccataag
actgagcacggggctcgacggcccaagcattcctactggcacgcgattggcgacattgcc
aacatgctggtgggtcgaaaggcgcctcctctgcccgagactctcaacgacgagattgag
aagaacattgcgaaggagcagggtattattgatccttgttag

DBGET integrated database retrieval system