KEGG   Yarrowia lipolytica: YALI0D16357gHelp
Entry
YALI0D16357g      CDS       T01033                                 

Definition
(RefSeq) YALI0D16357p
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
yli  Yarrowia lipolytica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YALI0D16357g
   01230 Biosynthesis of amino acids
    YALI0D16357g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YALI0D16357g
   00030 Pentose phosphate pathway
    YALI0D16357g
   00051 Fructose and mannose metabolism
    YALI0D16357g
   00052 Galactose metabolism
    YALI0D16357g
  Energy metabolism
   00680 Methane metabolism
    YALI0D16357g
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    YALI0D16357g
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     YALI0D16357g
Protein phosphatases and associated proteins [BR:yli01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YALI0D16357g
Messenger RNA biogenesis [BR:yli03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     YALI0D16357g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:2024128..2026989
Genome map
AA seq 953 aa AA seqDB search
MIEGISFASFVTHEKPKFVRALDFYKALGFLPTKEYKHGTDHHATDEEGAGSIQEVWLTS
SRAGVPSVTVKLRLSRHGNEHVSLPNLKHDWRSLVPSLVYYAPDLDAVRAAITPFLHEDH
STLLERPSHTNFIELYAIDPMGNLVGFSRRENPYSSAMQKPFSADDIGPQNFSKPNETKI
KGKKRIGVMTSGGDAPGMCAAVRAVVRAGIARGCEVYAVREGYEGLVKGGDLIEPLSWED
VRGWLSLGGTLIGTARCKEFREREGRLAGALNMVKNGIDALIVIGGDGSLTGADLFREEW
PSLIEELVTNGSITAEQAERHRHLDICGMVGSIDNDMATTDVTIGAYSSLDRICELVDFI
DATAQSHSRAFVVEVMGRHCGWLALMAGTATGADYIFIPEAAPDATQWAEKMTRVVKRHR
SQGKRKTVVIVAEGAIDSDLNPITAKMVKDVLDGIGLDTRISTLGHVQRGGPPVAADRVL
ASLQGVEAIDAILSLTPETPSPMIALNENKITRKPLVESVALTKKVADAIGNKDFAEAMR
LRNPEFVEQLQGFLLTNSADKDRPQEPAKDPLRVAIVCTGAPAGGMNAAIRSAVLYGLAR
GHQMFAIHNGWSGLVKNGDDAVRELTWLEVEPLCQKGGCEIGTNRSLPECDLGMIAYHFQ
RQRFDGLIVIGGFEAFRALNQLDDARHAYPALRIPMVGIPATISNNVPGTDYSLGADTCL
NSLVQYCDVLKTSASATRLRLFVVEVQGGNSGYIATVAGLITGAYVVYTPESGINLRLLQ
HDISYLKDTFAHQADVNRTGKLLLRNERSSNVFTTDVITGIINEEAKGSFDARTAIPGHV
QQGGHPSPTDRVRAQRFAIKAVQFIEEHHGSKNNADHCVILGVRGSKFKYTSVSHLYAHK
TEHGARRPKHSYWHAIGDIANMLVGRKAPPLPETLNDEIEKNIAKEQGIIDPC
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaggaatctcctttgcgtcgtttgtgacacacgaaaaacccaagtttgtgcgc
gccctggacttctacaaggccctgggcttcctccccaccaaggagtacaagcacggaaca
gaccaccatgccaccgacgaagaaggcgcgggctcgatccaggaggtctggctcacgtcg
tcgcgagccggtgtgccgtctgtgaccgtcaaattgcgactctcccgccacggaaacgaa
cacgtgtctctccccaacctcaaacacgactggcggtcgctggtgccctcgctggtgtac
tacgcccccgacctggacgcggtgcgagccgcaatcaccccgttcttacacgaggaccac
tccacgcttctggaacgcccttcccacacaaacttcatcgagctgtacgccattgacccc
atgggaaacctcgtgggcttttcccgacgagaaaacccttactcgtcagcgatgcagaaa
cccttctctgctgacgacattggcccgcagaacttctcaaagcccaatgaaaccaaaatc
aagggcaagaagcgtatcggtgtcatgacctccggaggagacgcccccggcatgtgtgcg
gccgtgcgagctgtggtccgagccggaattgcccgcggctgcgaggtctacgctgtccga
gagggctatgagggtcttgtcaagggtggcgacctcattgagcccctgtcatgggaagac
gtacggggctggctctccctgggaggaacccttattggaactgctcgatgcaaggagttc
cgagaacgagagggccgactggcaggagccctcaacatggtcaagaacggcattgacgcg
ctcattgtcattggcggagacggctcgttgaccggagccgatctgttccgagaagaatgg
ccgtctctaatcgaggagctagtcaccaatggctccatcaccgccgagcaggccgaacga
caccgacacctcgacatttgcggtatggtaggctccatcgacaacgacatggctaccacc
gacgtcaccattggtgcttactcatcgctcgaccgaatctgcgagctggtagacttcatc
gatgccaccgcccagtcgcactcgcgagcctttgtcgtcgaggttatgggtcggcactgt
ggctggctggctctcatggccggcactgctaccggcgccgactacatttttatccccgag
gctgctcccgatgctactcagtgggccgagaagatgacccgtgtcgtcaagagacaccga
agccagggcaagcgaaagaccgtggtcattgtcgccgagggcgcaatcgactcggacctc
aaccccatcactgccaagatggtcaaggatgtgctagacggcattggactcgatactcga
atctccaccctgggtcacgtacagcgaggaggtcccccagttgccgctgatagagttctg
gcttcactgcagggtgtggaggctatcgacgccatcctgtctctcaccccagagacgccc
agtcccatgattgctctcaacgagaacaaaatcacccgcaagccgctcgtggagtctgta
gctctcaccaagaaggttgccgatgccattggcaacaaggactttgccgaggccatgcgg
cttcgaaaccccgagtttgtggagcaattgcagggtttcctgctcacaaactctgctgac
aaggaccggccccaggagcctgccaaggatcccctgcgagtcgccattgtgtgcactggc
gctcctgctggcggaatgaacgctgccatccgatctgctgttctgtacggtcttgctcga
ggccaccaaatgtttgccatccacaatggatggtccggcctcgtcaagaatggtgacgac
gcggtgcgggagctgacttggctcgaggtcgagcccctgtgtcagaagggtggctgtgag
attggtactaaccgatctctgcccgaatgtgatcttggaatgattgcataccactttcag
cgacaacggtttgacggtctaatcgtcattggtggttttgaggctttccgagcgctgaat
cagctcgacgatgcccgtcacgcctaccctgctcttcgaatccccatggttggtattcct
gccaccatttcgaacaacgtgcctggaacggactattctcttggagccgacacttgtctc
aactctctggttcagtactgcgacgtgctcaagacgtctgcttctgccactcgtctgcgt
ctgtttgtggtcgaggtgcagggtggaaactctggttacatcgccaccgtggctggtttg
atcaccggcgcctatgtggtgtacacacccgagagcggtatcaacctgcgacttcttcag
cacgacatttcctaccttaaggatacttttgctcatcaggcggacgtgaaccgaaccgga
aagctgcttctgcgaaacgagcggtcatccaacgtgttcaccactgatgtcatcaccggc
atcatcaacgaggaggccaagggttcatttgacgcgcgaaccgccatccctggccatgtg
cagcagggaggacacccctctcctaccgatcgagtgcgtgctcagcgatttgccatcaag
gccgtgcagtttattgaagagcaccacggctccaaaaacaatgccgatcactgtgtgatt
ctcggtgtgcggggctccaagttcaagtacacctctgtgtcgcatctgtacgcccataag
actgagcacggggctcgacggcccaagcattcctactggcacgcgattggcgacattgcc
aacatgctggtgggtcgaaaggcgcctcctctgcccgagactctcaacgacgagattgag
aagaacattgcgaaggagcagggtattattgatccttgttag

DBGET integrated database retrieval system