KEGG   Yarrowia lipolytica: YALI0D19140gHelp
Entry
YALI0D19140g      CDS       T01033                                 

Definition
(RefSeq) YALI0D19140p
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
yli  Yarrowia lipolytica
Pathway
yli00620  Pyruvate metabolism
yli00630  Glyoxylate and dicarboxylate metabolism
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
yli01200  Carbon metabolism
Module
yli_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    YALI0D19140g
   00630 Glyoxylate and dicarboxylate metabolism
    YALI0D19140g
Enzymes [BR:yli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     YALI0D19140g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 2911154
NCBI-ProteinID: XP_503018
UniProt: Q6C8J4
Position
D:2419780..2421375
Genome map
AA seq 531 aa AA seqDB search
MTVNSTFRSASTSPKLGKTSQADILSPEAQKFLVELHSNFNQRRLELLDLRQKNQLKLDA
GEIPTYPTETADIRADKSWTGPSLAPGLHDRRVEITGPPDRKMIINALNTNVATYMSDFE
DSQAPTWDNCLDGQVNLYDAIRNQVDFDTEKKPYKLTTKKWTEGTYSRGSTDTRPTLLVR
PRGWHMLESHVQIDGQSMSGSLFDFGLFFFNNAKALIEAGRGPYFYLPKMEHYLEARLWN
DVFVFSQNYCGIPQGTIRATCLIETLPAALHMEEIIYELRDHSAGLNCGRWDYMFSVIKR
FRNQPEKLLPDRKMITMTVPFMNAYVTRLVHVCHKRKVHAMGGMAAIIPLKDAAENALAM
EKVKADKHREASAGCDGTWIAHPGLAETATKEFDELMPGENQFDFVGEDVPSEKLLDTTI
EGFAITKEGLQENVYIGLRYMEAWLRGLGCVPINNLMEDAATAEVSRAQLWQWTKHGKFT
KEEVLEMISQEAEKLGNTDSVKRAGELLGSEIGGDFAEFLTDLLYPDLVEQ
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcaactccacttttagatcggcatcaacttccccgaaactgggcaaaaccagc
caggcagacatcctgagccccgaggcccaaaagttcctggttgaactccacagcaacttc
aaccagcgacgtctggagctccttgatctgcgtcagaagaaccagctcaagctcgatgca
ggcgaaatccccacgtatcccacggaaacagcagacatccgagcagacaagtcgtggaca
ggtccatctctggctcccggtctccatgaccgacgggtcgaaatcactggccccccagac
cgaaagatgatcatcaacgccctcaacacaaacgtcgccacctacatgtccgatttcgag
gactcccaagcccccacctgggacaactgtctcgatgggcaagtcaacctgtacgatgcc
atccgaaaccaggttgatttcgacacagagaagaaaccctacaagctgactacaaagaag
tggaccgaggggacctactctagaggctccacggacactcgacccactcttttggtgcgc
cctagaggctggcacatgctcgaaagccatgttcagatcgatggacagagcatgtctggg
tctctgttcgactttggactcttcttcttcaacaacgccaaggctctgattgaggctggc
cgaggcccttacttttacctccccaagatggagcattatctcgaggctcgactctggaat
gatgtctttgttttctctcaaaactactgcggaatcccccagggcaccattcgagctact
tgtctgattgagactcttcctgcagctctgcacatggaggagatcatctacgagctgcga
gatcactctgccggcctcaactgtggtcgatgggactacatgttctcagttatcaagcgg
ttccgaaaccagcccgagaagctgcttcctgaccgaaagatgatcaccatgaccgttccc
ttcatgaacgcttacgtgactcgtctggttcacgtgtgtcacaaacgaaaggtgcatgcc
atgggaggtatggctgccatcattcctctcaaggatgctgcggagaacgcccttgccatg
gagaaggtcaaggctgacaaacacagagaggcctctgcaggctgtgacggtacctggatc
gctcatcccggtttggctgagactgccaccaaggagtttgacgagttgatgccaggggaa
aaccaatttgatttcgtcggagaggacgttccctccgagaagctgttggatactaccatt
gaaggctttgccatcaccaaggagggtcttcaggagaatgtctacattggtctgcgctac
atggaggcatggctgcgagggttgggatgtgtgcccatcaacaacctcatggaggatgct
gctactgccgaggtttctcgtgcccagctgtggcagtggaccaagcacggcaagttcacc
aaggaggaggtattggagatgatttcccaggaggccgagaagctgggaaacaccgactct
gtcaagcgagcaggcgagttgctgggatctgagattggcggcgattttgcagagttcctc
accgatctgctgtatcctgatctggttgaacagtag

DBGET integrated database retrieval system