KEGG   Yarrowia lipolytica: YALI0D19140gHelp
Entry
YALI0D19140g      CDS       T01033                                 

Definition
YALI0D19140p
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
yli  Yarrowia lipolytica
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YALI0D19140g
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    YALI0D19140g
   00630 Glyoxylate and dicarboxylate metabolism
    YALI0D19140g
Enzymes [BR:yli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     YALI0D19140g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:2419780..2421375
Genome map
AA seq 531 aa AA seqDB search
MTVNSTFRSASTSPKLGKTSQADILSPEAQKFLVELHSNFNQRRLELLDLRQKNQLKLDA
GEIPTYPTETADIRADKSWTGPSLAPGLHDRRVEITGPPDRKMIINALNTNVATYMSDFE
DSQAPTWDNCLDGQVNLYDAIRNQVDFDTEKKPYKLTTKKWTEGTYSRGSTDTRPTLLVR
PRGWHMLESHVQIDGQSMSGSLFDFGLFFFNNAKALIEAGRGPYFYLPKMEHYLEARLWN
DVFVFSQNYCGIPQGTIRATCLIETLPAALHMEEIIYELRDHSAGLNCGRWDYMFSVIKR
FRNQPEKLLPDRKMITMTVPFMNAYVTRLVHVCHKRKVHAMGGMAAIIPLKDAAENALAM
EKVKADKHREASAGCDGTWIAHPGLAETATKEFDELMPGENQFDFVGEDVPSEKLLDTTI
EGFAITKEGLQENVYIGLRYMEAWLRGLGCVPINNLMEDAATAEVSRAQLWQWTKHGKFT
KEEVLEMISQEAEKLGNTDSVKRAGELLGSEIGGDFAEFLTDLLYPDLVEQ
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcaactccacttttagatcggcatcaacttccccgaaactgggcaaaaccagc
caggcagacatcctgagccccgaggcccaaaagttcctggttgaactccacagcaacttc
aaccagcgacgtctggagctccttgatctgcgtcagaagaaccagctcaagctcgatgca
ggcgaaatccccacgtatcccacggaaacagcagacatccgagcagacaagtcgtggaca
ggtccatctctggctcccggtctccatgaccgacgggtcgaaatcactggccccccagac
cgaaagatgatcatcaacgccctcaacacaaacgtcgccacctacatgtccgatttcgag
gactcccaagcccccacctgggacaactgtctcgatgggcaagtcaacctgtacgatgcc
atccgaaaccaggttgatttcgacacagagaagaaaccctacaagctgactacaaagaag
tggaccgaggggacctactctagaggctccacggacactcgacccactcttttggtgcgc
cctagaggctggcacatgctcgaaagccatgttcagatcgatggacagagcatgtctggg
tctctgttcgactttggactcttcttcttcaacaacgccaaggctctgattgaggctggc
cgaggcccttacttttacctccccaagatggagcattatctcgaggctcgactctggaat
gatgtctttgttttctctcaaaactactgcggaatcccccagggcaccattcgagctact
tgtctgattgagactcttcctgcagctctgcacatggaggagatcatctacgagctgcga
gatcactctgccggcctcaactgtggtcgatgggactacatgttctcagttatcaagcgg
ttccgaaaccagcccgagaagctgcttcctgaccgaaagatgatcaccatgaccgttccc
ttcatgaacgcttacgtgactcgtctggttcacgtgtgtcacaaacgaaaggtgcatgcc
atgggaggtatggctgccatcattcctctcaaggatgctgcggagaacgcccttgccatg
gagaaggtcaaggctgacaaacacagagaggcctctgcaggctgtgacggtacctggatc
gctcatcccggtttggctgagactgccaccaaggagtttgacgagttgatgccaggggaa
aaccaatttgatttcgtcggagaggacgttccctccgagaagctgttggatactaccatt
gaaggctttgccatcaccaaggagggtcttcaggagaatgtctacattggtctgcgctac
atggaggcatggctgcgagggttgggatgtgtgcccatcaacaacctcatggaggatgct
gctactgccgaggtttctcgtgcccagctgtggcagtggaccaagcacggcaagttcacc
aaggaggaggtattggagatgatttcccaggaggccgagaagctgggaaacaccgactct
gtcaagcgagcaggcgagttgctgggatctgagattggcggcgattttgcagagttcctc
accgatctgctgtatcctgatctggttgaacagtag

DBGET integrated database retrieval system