KEGG   Yarrowia lipolytica: YALI0D23331gHelp
Entry
YALI0D23331g      CDS       T01033                                 

Definition
YALI0D23331p
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
yli  Yarrowia lipolytica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:yli00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:3035838..3037421
Genome map
AA seq 527 aa AA seqDB search
MSIQHTLYRPLKEGASLAILGGGIGGLLSAAFLARARPDIKITLYESKAQCGGWIKSKLL
ECHDGGSEMIEKGPRTLRMHPGTLILLQAISHVDPKFSIYGLPTDSPANTKWILNKDQLM
SLSVFKSPANLMRFLSSSVFRAMAMGAFNFLVYPWTRKRDPNVQDESVADFIGRRASPAL
GDRMGSAILHGIYAGDHKTLSARMTLRPFYGPDRLLKPAKLFTNEEFEKLYKKLFPEAST
SLFDLKKFPAMFAFPQGLSGMIDVLHKHLEKSPNVEIKCNTEITRVETTIGGMLVSDSTG
VSTTHNAVYSLLSYQAVSKLLPDTADRALIKDMSSVDVMVLNFSFEKPKDPKYTGFGYLI
PQAEENPEQVLGVIFDSDVGRGSELISGEPYKSPSGRENVTVMMGGHYWKDGNIPSSEEC
VERAKKVLKRHIGLEVTDTTEYDVELHKSCIPQYAVGHLERVDQFKHIVSKETHHRVALA
GMSFGRGVGISDAAVDAFLFVASQSHDPETLKLTRKIVDHYETTVRL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattcaacacacactgtacaggccattgaaggagggagcgagtttggcgatcctt
ggaggcggaattggcggacttctatccgcggcattcctcgccagagcgcgcccagacatc
aaaatcacactgtacgagtcaaaggcgcaatgtggaggatggatcaagagcaagttgctt
gaatgccacgatggcggctcggagatgatcgaaaagggaccccgaacgctcagaatgcac
cccggcacactcattttactccaggccatttctcatgtggacccaaagttctccatctac
ggactacctaccgacagtccagccaacaccaagtggatcctcaacaaggaccaactcatg
tcgctgagcgtgttcaagagccccgcaaatctgatgcggttcctgtcgtcgtctgtcttt
cgagccatggctatgggcgccttcaacttcctcgtatatccatggacccggaaacgagac
cctaatgtccaagacgaaagcgtggctgatttcatcggaagacgagcctcgcctgctctg
ggcgatagaatgggctcagcgattctacacggaatctacgctggagaccacaagactctg
agtgctcgaatgactctgcgaccattctacggacctgatagactgctgaaaccggccaaa
ttgttcaccaacgaggagtttgagaaactgtacaagaagctgtttcccgaggcgtccacg
tcgctgtttgatctcaagaagttcccggccatgtttgcctttccccagggtctgtctgga
atgattgatgtactccataagcatctggaaaaaagtcccaatgtggagattaaatgtaac
acggagattaccagagttgaaaccaccattggaggcatgcttgtgtctgattctaccggt
gtttctaccactcacaatgccgtctactctctgttgagttaccaggctgtgtccaaattg
cttcctgacactgccgaccgagctctcatcaaggacatgtcttctgtcgacgtcatggtg
ctcaacttctcattcgagaaacccaaggaccccaagtacaccggctttggatacctcatt
ccccaggccgaagaaaaccccgagcaggttctgggcgttattttcgactctgatgtcggt
cgaggcagtgagctcatctctggtgagccctacaagtcgccttcgggccgagaaaatgtc
acagtcatgatgggaggtcattactggaaggatggtaatattccgtcttccgaggagtgt
gtggagagagcaaagaaggtgctcaaacgacacattggcctggaggtgactgataccacc
gagtacgatgtggagctgcacaagagctgcattcctcagtacgccgttggtcatctggag
cgtgtggaccagtttaagcacattgtcagcaaggagactcatcatcgagtggctctggca
ggcatgtcgttcggtcgaggagtgggtatctctgatgccgctgttgacgcctttttgttt
gtggctagtcagagtcatgatccggagacgttgaaattgacgagaaagattgtggatcat
tatgagaccaccgtacgactttag

DBGET integrated database retrieval system