KEGG   Yarrowia lipolytica: YALI0D23683gHelp
Entry
YALI0D23683g      CDS       T01033                                 

Definition
YALI0D23683p
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
yli  Yarrowia lipolytica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YALI0D23683g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YALI0D23683g
   00020 Citrate cycle (TCA cycle)
    YALI0D23683g
   00620 Pyruvate metabolism
    YALI0D23683g
Enzymes [BR:yli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     YALI0D23683g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:3079166..3080476
Genome map
AA seq 436 aa AA seqDB search
MTQGNIGAWQKSVGDALAPGEVLVEIETDKAQMDFEFQDDGYLAKILLDAGAKDIAVGTP
IGVYVEDEADVAAFKDFTIDDAGGVPKPPKTEEQKEEEEYEAEKAEKAEKEAEASKETAS
PAPSSQSSAPAAPTPPSSRIFASPMAKTIALEKGIKLSEIKGSGPGGRIIKRDVENWTPP
AAPAAKAAPAKGAAPAAAAAAGSAYTDIPLTNMRKTIASRLTQSKNTSPDYIVSSTVSVS
KLLKLRAALNASSDGTYKLSINDLLVKALAVANTKVPQVNSQWLESEGVIRQFTNVDVSV
AVATPTGLITPVVKNANLKGLAEISKEIKALGKKAKDGKLAPEEYQGGTVTISNLGMNHA
VSFFTAIINPPQAAILAVGTTERKAIEDVDSEAGFVFDDVVTLTTSFDHRVVDGAVGGEW
VKALKQVVENPIEMLL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacccagggtaacattggcgcctggcaaaagtctgtcggcgacgctcttgctcccggc
gaggttctcgtcgagattgagactgacaaggcccagatggactttgagttccaggatgat
ggctacctggccaagattctgctcgacgccggagccaaggacattgccgttggcaccccc
attggtgtctacgtcgaggacgaggccgacgtggctgccttcaaggacttcaccattgac
gacgccggaggagtccccaagcctcccaagaccgaggagcagaaggaagaggaggaatac
gaggccgagaaggccgagaaggccgagaaggaggccgaggcttccaaggagactgcttct
cccgccccctcttctcagtcctctgcccctgctgcccccactcccccctcttctcgaatc
tttgcttctcccatggccaagaccattgctctggagaagggcatcaagcttagcgagatc
aagggctccggtcccggtggtcgaatcatcaagcgagacgtcgagaactggacccctccc
gccgctcccgccgccaaggctgcccctgccaagggcgctgcccctgctgctgccgctgct
gctggatctgcttacaccgacattcctctcaccaacatgcgaaagacaattgcttctcga
ctgacccagtccaagaacacatctcccgactacattgtgtcttccaccgtgtctgtgtcc
aagctgctcaagctgcgagctgctctcaacgcctcctccgatggtacctacaagctgtcc
atcaacgatctgcttgtcaaggccctggccgtggccaacaccaaggtcccccaggtcaac
tcccagtggctcgagtctgagggtgttattcgacagttcaccaacgtggacgtttctgtc
gccgttgccacccccactggtctgatcacccctgtggtcaagaacgccaacctcaagggt
ctggcggaaatctccaaggagattaaggctctgggcaagaaggccaaggacggcaagctg
gctcccgaagagtaccagggcggtaccgtgaccatttccaacctgggcatgaaccacgcc
gtgtccttcttcactgccatcatcaaccctccccaggccgccattctcgctgtcggcacc
accgagcgaaaggccattgaggacgttgactccgaggccggctttgtctttgacgacgtt
gttactctgaccacctctttcgaccaccgagtcgtcgatggagctgttggaggcgagtgg
gtcaaggctctcaagcaggtggttgaaaaccccattgagatgttgttgtag

DBGET integrated database retrieval system