KEGG   Yarrowia lipolytica: YALI0D24211gHelp
Entry
YALI0D24211g      CDS       T01033                                 

Definition
YALI0D24211p
Orthology
K11873  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     YALI0D24211g
Peptidases [BR:yli01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   YALI0D24211g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:complement(3197071..3198465)
Genome map
AA seq 464 aa AA seqDB search
MTSVMKRQNGGGNPFQQHRLLTQIKDKPISFVRAKNPEPVAIKPASYILIKPKQREEEDT
SPGTTLSAATPTNFIPLSATLDPGSRSPSKIQKAWKKGTPSPAGLINQGVTCYMNSAVQL
LMHMPAMSNYLADILLAKKYPGSVTQVFAQLYGKLFGGKKNIFPRQLIGRLDDINCMMSE
WNQEDAHEYFMSLMSRLQEDSTPKGEKLNSSVIYDMFGGNLEQVVVCGGCGNESVTKQDF
YDLSVNLDEKKPEGRISLKRCITRFFEEEQIQKKDGYKCDECQKTTSAKKTSRIHEFPEH
LVVHVKRFKFVNDQPRKMGAPLDYPADLDLGHYSRDKQRAGVVPYKLIGVIAHCGRTTGS
GHYIAHVRQPNGKWATYDDDLIEPLSEKKALKEEDAYMLMYQRLTPQASKSKSASGPKSV
AMGTPKAAGKVTKPVVKTGKGQRKMADIDNIFASAKRKKNSGFV
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgtgatgaaacgccaaaatggaggcgggaacccgttccaacagcaccgactg
ctgactcagatcaaagacaagccaatcagctttgtgcgtgccaaaaacccggagccagtc
gctatcaaacccgcgtcatacattctcatcaagcccaagcaaagagaagaggaggacaca
agccctggaacaacgttgtccgccgccactccgaccaacttcatccctctgagcgccaca
ttggatcctggatcgcgctcacccagcaagattcaaaaggcgtggaagaagggtactccc
tcgccggctggtctcatcaaccagggagtcacgtgctacatgaactcggcggtgcagctg
ctcatgcacatgcccgccatgagcaactacctcgctgatattctgctggccaaaaagtac
ccggggtccgtgactcaggtgtttgcccagctttacggcaagctgtttggcggtaagaag
aacatcttccctcgccaactcatcggccgactcgacgacatcaactgcatgatgtccgaa
tggaaccaggaagatgctcacgagtacttcatgtcgctcatgagccggctgcaggaagac
tccacccccaaaggcgagaagctcaacagctccgtcatttacgatatgtttggaggcaac
ctggagcaggtggtagtttgtggaggctgtggcaacgagtccgtgaccaagcaggacttt
tacgacctctcggtcaacctggatgagaagaaacccgagggacgaatctctctcaaacga
tgcatcactcggttctttgaggaggagcagatccagaagaaggacggatacaagtgcgac
gagtgccaaaagacaaccagcgccaagaaaacctcgcgaatccacgagttcccggaacac
ctcgtggtccacgtgaaacggttcaagtttgtcaacgaccagccccgcaagatgggcgcg
ccgttggattacccggccgacctcgatctgggccactactcacgggacaagcagcgggcc
ggtgtggtgccgtacaagctcattggtgtcattgcccactgtggccgaacaaccggctcg
ggccattatattgctcacgtgagacagcccaacggcaagtgggccacctatgatgacgat
ctcattgagccgctgtcggagaaaaaggcgctcaaggaggaggatgcgtacatgctcatg
tatcagcgtctgacgccgcaggcgtccaagtcgaagtcggcgtctggcccgaaatccgtc
gccatgggaacaccaaaggctgctggcaaggtgacaaagcccgtggtgaagactggcaag
gggcagcgaaagatggccgatattgacaacatttttgcatctgcgaagcgcaagaagaac
tcgggctttgtttag

DBGET integrated database retrieval system