KEGG   Yarrowia lipolytica: YALI0D24299gHelp
Entry
YALI0D24299g      CDS       T01033                                 

Definition
YALI0D24299p
Orthology
K03259  
translation initiation factor 4E
Organism
yli  Yarrowia lipolytica
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    YALI0D24299g
Translation factors [BR:yli03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    YALI0D24299g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:complement(3215595..3216362)
Genome map
AA seq 255 aa AA seqDB search
MAATTDNVTEAVANLNIKEEAPVASEPAEVTETVEEEVTPAEPFSTVFDSKTEFATVHKL
TTPWTLWYIKPPSPAVAWHDLIKEVVSFDTVEGFWAVYNNIPKLVELPIRSDYAFFRKGI
RPEWECDSNKAGGKWFYQFKPKSANEFDEIWLHTVLSVIGESLETDEEIAKHEGKYNNVD
GSASNVNGIFVNIRKAGVRFNVWTKTSEVTDELRQMGVKIKQVLRLPEKEEVQFQSHEES
ASKNVKSQGKTRLAV
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggccgctactactgacaacgtgactgaagctgtcgccaacctcaacatcaaggaggag
gcccccgttgcttccgagcctgccgaggtgaccgagacagtcgaggaggaggtgaccccc
gcggagcccttcagcaccgtgttcgactccaagactgagtttgccaccgtccacaagctg
accaccccctggactctgtggtacatcaagcccccttcccccgcggttgcctggcacgat
ctgatcaaggaggtggtgtcgttcgacaccgttgagggcttctgggcggtgtacaacaac
atccccaagctggtggagctacccatccggtcggactatgcatttttcagaaagggcatc
cggcccgagtgggagtgtgactccaacaaggccggcggcaagtggttctaccagttcaag
cccaagtctgccaacgagtttgacgagatttggctccacacggtgctgtctgtgattggc
gagagcctcgagaccgacgaggagattgccaagcacgagggcaagtacaacaacgtggac
ggctcggcctccaacgtgaacggcatttttgtcaacatccgaaaggccggtgtgcggttc
aacgtctggaccaagacctccgaggtgaccgacgagctgcgccagatgggcgtcaagatc
aagcaggtgctgcgtctgcccgagaaggaggaggtccagttccagtcccatgaggagtcg
gcctccaagaacgtcaagtcgcagggcaagaccagactggcggtttag

DBGET integrated database retrieval system