KEGG   Yarrowia lipolytica: YALI0D25630gHelp
Entry
YALI0D25630g      CDS       T01033                                 

Definition
YALI0D25630p
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
yli  Yarrowia lipolytica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    YALI0D25630g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YALI0D25630g
  Lipid metabolism
   00071 Fatty acid degradation
    YALI0D25630g
  Amino acid metabolism
   00350 Tyrosine metabolism
    YALI0D25630g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     YALI0D25630g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
D:complement(3413441..3414490)
Genome map
AA seq 349 aa AA seqDB search
MTTIPKTQKAVIFETSGGPLMYKDVPVPVPADDEILVNVKFSGVCHTDLHAWKGDWPLDT
KLPLIGGHEGAGVVVAKGKNVTTFEIGDYAGIKWINKACYTCEFCQVSAEPNCPKATMSG
YTHDGSFQQYATANAVQAAHIPKNCDLAQIAPILCAGITVYKALKTAGLKAGEWAAVTGA
GGGLGSLAVQYAKAMGYRVLAIDTGADKEKMCKELGAEVFIDFAKSKDLVKDVQDATKGG
PHAVINVSVSEFAVNQSVEYVRTLGTVVLVGLPAGAVCKSPIFQQVARSIQIKGSYVGNR
ADSQEAIEFFARGLVKSPIIIVGLSQLESVYKLMEEGKIAGRYVLDTYK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatccccaagacccagaaggctgtcattttcgagacctccggcggtcctctc
atgtacaaggacgtgcctgtgcctgttcctgccgacgacgagattctcgtcaacgtcaag
ttttccggagtgtgccacactgacctccatgcctggaagggcgactggcctcttgacacc
aaacttcctctcattggcggccacgagggcgccggagttgtcgtggccaagggcaagaac
gtgaccaccttcgaaatcggcgactacgccggtatcaagtggattaacaaggcctgttac
acctgtgagttctgccaggtgtctgccgagcccaactgtcctaaagctaccatgtcggga
tacacccacgacggctcgttccagcagtacgccactgccaacgctgtccaggcagcccat
atccccaagaactgcgacctcgcccagattgctcccattctctgcgccggcatcaccgtc
tacaaggctcttaagaccgctggcctcaaggctggtgagtgggccgccgttaccggagct
ggaggaggcctcggttctctggccgtccagtacgctaaggccatgggctaccgagtgctg
gccattgacaccggcgccgacaaggagaagatgtgcaaggagctcggcgccgaggtcttc
atcgactttgctaagtccaaggatctggtcaaggacgtccaggatgccaccaagggcgga
ccccacgccgttatcaacgtgtctgtctccgagtttgccgtcaaccagtccgtcgagtac
gtgcgaactctgggcaccgtggttctggtcggcctgcccgctggagctgtctgcaagtcg
cccatcttccagcaagtggctcgatccattcagatcaagggttcctatgttggcaaccga
gccgactcgcaggaggccattgaattcttcgcccggggccttgtcaagtctcccattatt
attgtgggtctttcccagctggagtccgtctacaagctgatggaggagggcaagattgcc
ggcagatacgttctggacacttacaagtaa

DBGET integrated database retrieval system