KEGG   Yarrowia lipolytica: YALI0E02310gHelp
Entry
YALI0E02310g      CDS       T01033                                 

Definition
YALI0E02310p
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
yli  Yarrowia lipolytica
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    YALI0E02310g
  Metabolism of other amino acids
   00480 Glutathione metabolism
    YALI0E02310g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     YALI0E02310g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:255377..255883
Genome map
AA seq 168 aa AA seqDB search
MSAEKTNTAFYNLAPLDKNGEPFPFKQLEGKVVLIVNVASKCGFTPQYKGLEEVYQKYKD
QGFTIIGFPCNQFGGQEPGSADEISSFCQLNYGVTFPVLQKINVNGNDADPVYVYLKEQK
AGLLGFRGIKWNFEKFLVDKHGNVVDRYASLKTPAGLESTIETLLKKP
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgagaaaaccaataccgctttctacaacctcgctccactcgacaagaacgga
gagcctttccccttcaagcagcttgagggcaaggtcgtgctcatcgtgaacgtcgcctcc
aagtgtggctttactccccaatacaagggccttgaggaggtctaccagaagtacaaggat
cagggattcaccatcatcggcttcccctgcaaccagtttggtggccaagagcctggttcc
gctgacgagatctcctccttctgtcagctgaactacggcgtcactttccccgttcttcag
aagatcaacgtcaacggcaacgacgccgaccccgtctacgtctacctgaaggagcagaag
gctggtctgctgggcttccgaggaatcaagtggaactttgagaagttcctggttgataag
cacggtaacgtcgtcgaccgatatgcttccctcaagacccccgccggcctcgaatccacc
atcgagaccctcctcaaaaagccctaa

DBGET integrated database retrieval system