KEGG   Yarrowia lipolytica: YALI0E02420gHelp
Entry
YALI0E02420g      CDS       T01033                                 

Definition
YALI0E02420p
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
yli  Yarrowia lipolytica
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YALI0E02420g
Enzymes [BR:yli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     YALI0E02420g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:complement(269480..271333)
Genome map
AA seq 617 aa AA seqDB search
MRITRLLLLAAAAVAAVIPTPKPEGEEEAPAPCPEISGKEWETTVAEGTYWVKFYSPQCG
HCQMLAPKWERMYQEIGNDVASRHDFHIAAVNCLADGDLCNQENINVYPTLNLYKNGKKV
ETYDLRKGTQPSRLAKFVEEKIKEASGISKLEGDEEKIASTKKANVNVEGLSVDLNPTNF
KALVSDDPTGWYIKYYLPSCPHCVAMDDAWNEVAAKFKNQLNVGEINCAKYADFCRGQGI
EYYPAVTFQIGELSVTYNGERTTDALTLFGLQAVEARDMKSVNQLEFEELRQKHPETVSY
IYLHDEALFPEDLQALQKFAINVVAHANVYKSDDKKLVDKFSVTRLPALVAVNNDYTDEM
SFEVYPEYDVGHLRNSERLLQFARRTWLPLMPELTPINQDSVFADGRIVVLALVDREDKF
ATKVAIDELKQSATKYFKAKMHARQKELDLLRIQRHSERAKLLKEKDPKLQKKLEKDDTS
VPTRPPVQFAWIDADKYSKWIESRFRFNWDDRKANAPIIVIDDAKNVQFFDTDDKNARLE
PSDAEQLARVLDLIEKNNSRQLFPRSTRGFFASWFIFVWGLKTYILLVFVLLAVAKMGKR
YLRHRRSAATPTLGKWE
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcacacgactgctgttgttggcagccgccgctgttgcagcagtaattcccaca
cccaaacccgaaggtgaagaggaggcccctgcgccttgccccgagatttccggcaaggaa
tgggagaccaccgtagctgagggaacctactgggtcaagttctattcgccacaatgcggc
cactgccagatgctggcaccaaagtgggaacgaatgtaccaggaaattggtaatgacgtt
gcatcccgacacgacttccacattgctgctgtcaactgtctggctgacggagacttgtgt
aaccaggagaacatcaatgtctaccccaccctcaacctgtacaagaacggaaagaaggta
gagacttacgatctgagaaaggggacacagcccagcagactggcaaagtttgtggaggaa
aaaatcaaggaggcctccggtatctccaagctggagggagacgaggagaagatcgcttcc
acaaagaaggctaacgtgaacgttgagggactttctgtcgacctgaaccccaccaacttc
aaggctcttgtttctgatgatcctactggctggtacatcaagtactaccttccctcgtgt
cctcactgtgttgccatggatgacgcttggaacgaggtggctgccaagttcaagaaccag
ctcaatgttggtgagattaactgcgccaagtacgctgatttttgccgaggccagggtatc
gagtactatcccgccgtgactttccagatcggagagctctctgttacatacaacggcgag
cgaactaccgatgctctgaccctctttggtctgcaggccgttgaggctcgagacatgaag
tccgtcaaccagcttgagttcgaggaacttcgacagaagcaccccgagaccgtgtcttac
atctatcttcacgacgaggccctcttccccgaggatctgcaggctcttcagaagttcgcc
attaacgttgtcgcccatgccaatgtctacaaaagtgacgacaagaagctggtggacaag
ttttctgtcacccgacttcccgctcttgttgctgtcaacaatgactacactgatgagatg
tcctttgaggtctacccagagtacgatgttggccaccttcgaaactctgaacgactcctg
cagtttgctcgacgaacttggctccctctcatgcctgagctgacccctatcaaccaggat
tctgttttcgctgacggccgaatcgtcgttcttgctctcgtcgaccgtgaagacaaattc
gccaccaaggttgccatcgatgagctcaagcagtcggccaccaagtacttcaaggccaag
atgcatgctcgacagaaagagttggatctcctgcgaatccaacggcacagtgagcgagcc
aagctgctcaaggagaaggatcccaagctccagaagaagctcgagaaggatgacacctct
gttcctacccgacctccagtccagtttgcttggatcgacgccgacaagtactccaagtgg
atagagagccgattccgattcaactgggacgaccgaaaggctaacgctcctatcatcgtc
attgatgatgcgaagaacgttcagttctttgacaccgacgataagaacgccaggcttgaa
ccctctgatgcggagcagctcgcccgtgtgcttgatcttattgagaagaacaacagtcga
cagctcttcccgcgaagcactcgagggttcttcgcttcttggttcatcttcgtctgggga
cttaagacgtacattcttttggttttcgtgctcctggccgttgccaagatgggcaagcgc
tacctcagacaccgtcgatctgctgctacccccactcttggtaaatgggagtag

DBGET integrated database retrieval system