KEGG   Yarrowia lipolytica: YALI0E02772gHelp
Entry
YALI0E02772g      CDS       T01033                                 

Definition
YALI0E02772p
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     YALI0E02772g
Transcription machinery [BR:yli03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     YALI0E02772g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:306226..307620
Genome map
AA seq 464 aa AA seqDB search
MDSDTESVKRRKSSGSESESSVRDPKRTKIEDEDFQENGIDDEDEEEEEEEAKDEGDEDD
EEKGEDDEEDDEEKEGEDGEGEEEDEEEDEEKKREEEEKYVTSFNFDGVEYKYKERPAVI
EEREGKIEFRVVNNDNSKENLMILTGLKNIFQKQLPKMPREYIARLVYDRSHVSMAVVRK
PLTVVGGITFRPFDTRKFAEIVFCAISSTEQVRGYGAHLMNHLKDYVKATSPVMYFLTYA
DNYAIGYFKKQGFSKEISLDRSVWMGYIKDYEGGTLMQCSMLPRIRYLDVNKILLLQKAL
IHKKIRAISKSHVVRKGLDHFRDSTTPVDPMTIPGLKEAGWTPEMDELARRPKRGPHFAV
MQHVLSELQNHASAWPFAQAVNRDEVPDYYEVIKEPMDLSTMEQRLEADSYKTMEEFVYD
ARLVFNNCRAYNNETTTYYKNANKLEKFMVAKIKEIPEYSHLVE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggattcggatactgagtcagtgaaacgaagaaagtcctccgggtccgaaagcgagtcg
agcgtgcgagatccgaaacgaaccaagattgaagatgaggatttccaggagaacggcata
gacgatgaggatgaggaggaggaagaggaggaagctaaggacgaaggggatgaagacgac
gaagaaaaaggagaggacgacgaggaggacgatgaagaaaaagaaggcgaggatggagaa
ggagaggaagaagacgaagaggaggatgaggagaagaagcgagaggaggaggagaagtac
gttaccagcttcaactttgatggtgtggaatacaagtacaaagagcgaccagcagtgatt
gaggagcgtgaaggaaagattgaatttcgtgttgtcaacaacgataactccaaggaaaac
ctcatgatcctgacaggtctcaagaacattttccagaaacagctgcccaaaatgcctcga
gagtacattgcccgactagtgtacgacagaagtcatgtgtcaatggcagttgttagaaag
cctctcacggtggtcggaggaattacatttcggccgttcgatacccggaagtttgctgaa
atcgtcttctgtgccatcagtagtacagagcaggtccgaggatacggagcgcacttgatg
aaccatttgaaggactacgttaaggctacatcgcctgtgatgtactttctgacatacgcc
gataactatgccattggatacttcaagaagcagggtttctccaaggagatctccctcgac
agatcggtgtggatgggatacatcaaggattacgagggaggtactctcatgcagtgctcc
atgctgccacgaatcagataccttgacgtcaacaagattcttctgctacagaaggcactg
attcacaagaagatccgggccatctccaagagtcatgttgtgcgaaaaggcctcgaccac
tttcgtgattcgaccacgccagtggaccccatgacgatcccgggcttgaaggaggctgga
tggacacctgagatggacgagttggctagacgaccaaagcgaggtcctcattttgcagtc
atgcagcacgtgctgtcagagttgcagaaccacgcttctgcttggccgtttgcccaggct
gttaaccgagacgaggtgcccgactactatgaggtcattaaggagcccatggatctctca
acgatggagcaacgtctcgaagctgactcttacaagaccatggaggagtttgtgtatgac
gctcggttggtgttcaataactgtcgtgcttacaacaacgagacgacgacttactataag
aatgccaacaagctagagaagttcatggtggccaaaatcaaagagatccctgagtactct
catttggtggagtaa

DBGET integrated database retrieval system