KEGG   Yarrowia lipolytica: YALI0E03036gHelp
Entry
YALI0E03036g      CDS       T01033                                 

Definition
YALI0E03036p
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
yli  Yarrowia lipolytica
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YALI0E03036g
Enzymes [BR:yli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     YALI0E03036g
Exosome [BR:yli04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   YALI0E03036g
  Exosomal proteins of colorectal cancer cells
   YALI0E03036g
  Exosomal proteins of bladder cancer cells
   YALI0E03036g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:complement(321501..323015)
Genome map
AA seq 504 aa AA seqDB search
MKFTALTIALMGALAAASDVVKLDSDNFADFVTDNKLVLAEFFAPWCGHCKQLAPEYESA
ATILKEKGIPIGKVDCTENEELCSKFEIQGYPTLKIFRGSEEDSSLYQSARTSEAIVQYL
LKQALPLVSEFANEKELNAFTKDNDVTIVAFHDEDDEKSQSTFQRVAQKLRERFTFGHSA
DKALAKKYGVEKFPALVVYRNFDEKPAVYDISAGKKVFKFKPEPLTKFIKTEAVPVIGEI
GPASFQDYATSGLPLVYIFSALEKDTKQISEWVKPWAEKLKGEAYVGVIDADLYGSHAQN
VNIQEKFPAIAIENFDNKKKWAHAQDAKITKASVDKFFKEYIEGTLEPILKSDPVPEYQD
GPVHIVVGKNYKDIVLDDDKDVLIEFYAPWCGHCKILAPIYDELGDLFFDHPEISKKVTV
AKIDATTNEFPDEDVKGFPTIKLYPAGKKNAPITYPGARTLEGLNQFIKEHGTHKVDGLA
HADEEEAPAKDTKAKKGGKIDDEL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcactgccctcacaattgcgctcatgggcgctctggctgcggcctccgacgtc
gtcaagctcgattccgacaactttgccgactttgtcactgacaacaagctcgtcctcgct
gagttctttgctccctggtgcggacactgcaagcaactcgcccccgagtacgagtctgca
gccaccatccttaaggagaagggcatccccattggaaaggtcgactgtaccgagaacgag
gagctctgctccaagtttgagatccagggctaccccaccctcaagatcttccgtggatct
gaggaggacagctctctctaccagtctgcccgaacctccgaggcaattgtccagtacttg
ctgaagcaggcccttcctctcgtttccgaattcgccaacgagaaagagctcaatgccttc
accaaggacaacgacgtcaccattgttgccttccacgatgaggatgacgagaagtctcag
tccaccttccagcgagtcgcacagaagctccgagagcgattcactttcggccactccgct
gacaaggcccttgccaagaagtacggtgtcgagaagttccccgctctcgttgtctaccga
aacttcgatgagaagcccgccgtttacgacatctctgctggcaagaaggtgttcaagttt
aagcccgagcctcttaccaagttcatcaagaccgaggctgtccccgtcattggtgagatt
ggtcccgcttctttccaggactacgccacatctggcctccctctggtctacatcttctct
gctctggagaaggacaccaagcagatctccgagtgggtcaagccttgggctgagaagctg
aagggtgaggcttatgtcggtgtcattgacgctgacctctacggatctcacgcccagaac
gtcaacatccaggagaagttccctgccatcgctatcgagaacttcgacaacaagaagaag
tgggcccatgctcaggatgccaagatcaccaaggcctccgtcgacaagttcttcaaggag
tacattgagggaactctcgagcctatcctcaagtctgaccccgtccccgagtaccaggat
ggtcccgtccacattgttgtcggcaagaactacaaggatattgttctcgatgatgacaag
gatgttctgatcgagttctacgctccctggtgcggacactgcaagattcttgctcccatc
tacgacgagcttggagacctcttcttcgaccaccccgagatctccaagaaggttactgtc
gccaagatcgacgccaccactaacgagttccctgatgaggatgtcaagggtttccccact
atcaagctgtaccccgccggtaagaagaacgcccctatcacctaccccggtgctcgaacc
cttgagggtcttaaccaattcatcaaggagcacggtacccacaaggttgacggtctcgcc
catgccgatgaggaggaggcccctgccaaggataccaaggccaagaagggaggcaagatt
gatgatgagctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system