KEGG   Yarrowia lipolytica: YALI0E03036gHelp
Entry
YALI0E03036g      CDS       T01033                                 

Definition
(RefSeq) YALI0E03036p
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
yli  Yarrowia lipolytica
Pathway
yli04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YALI0E03036g
Enzymes [BR:yli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     YALI0E03036g
Chaperones and folding catalysts [BR:yli03110]
 Protein folding catalysts
  Protein disulfide isomerase
   YALI0E03036g
Membrane trafficking [BR:yli04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    YALI0E03036g
Exosome [BR:yli04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   YALI0E03036g
  Exosomal proteins of colorectal cancer cells
   YALI0E03036g
  Exosomal proteins of bladder cancer cells
   YALI0E03036g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_8 Thioredoxin_2 OST3_OST6 Calsequestrin ERp29_N AhpC-TSA Thioredoxin_7 Redoxin HyaE
Motif
Other DBs
NCBI-GeneID: 2912125
NCBI-ProteinID: XP_503481
UniProt: Q6C781
Position
E:complement(321501..323015)
Genome map
AA seq 504 aa AA seqDB search
MKFTALTIALMGALAAASDVVKLDSDNFADFVTDNKLVLAEFFAPWCGHCKQLAPEYESA
ATILKEKGIPIGKVDCTENEELCSKFEIQGYPTLKIFRGSEEDSSLYQSARTSEAIVQYL
LKQALPLVSEFANEKELNAFTKDNDVTIVAFHDEDDEKSQSTFQRVAQKLRERFTFGHSA
DKALAKKYGVEKFPALVVYRNFDEKPAVYDISAGKKVFKFKPEPLTKFIKTEAVPVIGEI
GPASFQDYATSGLPLVYIFSALEKDTKQISEWVKPWAEKLKGEAYVGVIDADLYGSHAQN
VNIQEKFPAIAIENFDNKKKWAHAQDAKITKASVDKFFKEYIEGTLEPILKSDPVPEYQD
GPVHIVVGKNYKDIVLDDDKDVLIEFYAPWCGHCKILAPIYDELGDLFFDHPEISKKVTV
AKIDATTNEFPDEDVKGFPTIKLYPAGKKNAPITYPGARTLEGLNQFIKEHGTHKVDGLA
HADEEEAPAKDTKAKKGGKIDDEL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcactgccctcacaattgcgctcatgggcgctctggctgcggcctccgacgtc
gtcaagctcgattccgacaactttgccgactttgtcactgacaacaagctcgtcctcgct
gagttctttgctccctggtgcggacactgcaagcaactcgcccccgagtacgagtctgca
gccaccatccttaaggagaagggcatccccattggaaaggtcgactgtaccgagaacgag
gagctctgctccaagtttgagatccagggctaccccaccctcaagatcttccgtggatct
gaggaggacagctctctctaccagtctgcccgaacctccgaggcaattgtccagtacttg
ctgaagcaggcccttcctctcgtttccgaattcgccaacgagaaagagctcaatgccttc
accaaggacaacgacgtcaccattgttgccttccacgatgaggatgacgagaagtctcag
tccaccttccagcgagtcgcacagaagctccgagagcgattcactttcggccactccgct
gacaaggcccttgccaagaagtacggtgtcgagaagttccccgctctcgttgtctaccga
aacttcgatgagaagcccgccgtttacgacatctctgctggcaagaaggtgttcaagttt
aagcccgagcctcttaccaagttcatcaagaccgaggctgtccccgtcattggtgagatt
ggtcccgcttctttccaggactacgccacatctggcctccctctggtctacatcttctct
gctctggagaaggacaccaagcagatctccgagtgggtcaagccttgggctgagaagctg
aagggtgaggcttatgtcggtgtcattgacgctgacctctacggatctcacgcccagaac
gtcaacatccaggagaagttccctgccatcgctatcgagaacttcgacaacaagaagaag
tgggcccatgctcaggatgccaagatcaccaaggcctccgtcgacaagttcttcaaggag
tacattgagggaactctcgagcctatcctcaagtctgaccccgtccccgagtaccaggat
ggtcccgtccacattgttgtcggcaagaactacaaggatattgttctcgatgatgacaag
gatgttctgatcgagttctacgctccctggtgcggacactgcaagattcttgctcccatc
tacgacgagcttggagacctcttcttcgaccaccccgagatctccaagaaggttactgtc
gccaagatcgacgccaccactaacgagttccctgatgaggatgtcaagggtttccccact
atcaagctgtaccccgccggtaagaagaacgcccctatcacctaccccggtgctcgaacc
cttgagggtcttaaccaattcatcaaggagcacggtacccacaaggttgacggtctcgcc
catgccgatgaggaggaggcccctgccaaggataccaaggccaagaagggaggcaagatt
gatgatgagctttaa

DBGET integrated database retrieval system