KEGG   Yarrowia lipolytica: YALI0E04202gHelp
Entry
YALI0E04202g      CDS       T01033                                 

Definition
YALI0E04202p
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
yli  Yarrowia lipolytica
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    YALI0E04202g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     YALI0E04202g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:473964..475154
Genome map
AA seq 396 aa AA seqDB search
MDSEYGDLSVEQKPIKDHSHSHHHHDHGHGHGNGHVEVEYLNLPGNNFYEDLDAELNGPL
YAGIQTFAHLGHVSCFDPTNFASEQFDIALVGAPFDTAVTFRSGARFGPAGIRKGSRRMS
PGQVSPYREGFMLYDDWAKFVDCGDVAMHPLDNRYALNQLYRGMRAIHNHTTSTLNATHI
PRAILMGGDHTTTLSALQAIYEKIGPVSVIHFDSHIDTWDPMVLGGNVSSYMQVNHGTFL
HYAAERGYLNHGHNLHVGSRAPYVRKHGDIEHDKHCGFAIVNAREIDEVGIAGVVQKIKD
RVGNTNVYISVDIDVLDPVYAPGTGTAEPGGYTTREFMQILDGLEGINIVGADVVEVAPA
YDGPGDVTLLAAAQVIDSLASLMVMNGPLSTRQSTK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggattccgagtatggtgatctgtccgtcgaacagaagcccatcaaggatcacagtcat
tcacaccaccatcatgatcacggccacggtcatggaaatggacacgttgaggtagagtat
ctgaatctcccgggtaacaacttctacgaagatctggatgccgagctcaatggacctctt
tatgctggcattcaaacctttgctcatctgggacatgtttcgtgctttgatcccaccaac
tttgcatccgagcaattcgatatcgctctagttggggctccttttgacacagcggtcact
ttcaggtcgggtgctagattcggaccggctggaatccgaaagggatccagaagaatgtct
ccaggacaggtcagtccatacagagagggattcatgctctacgacgattgggccaagttc
gttgactgtggtgatgttgccatgcatccccttgacaatagatacgcgcttaaccagctc
tatcgaggaatgagagctattcacaaccacacgacctccactctcaatgccacgcatatt
cccagagccattcttatgggtggcgatcacactaccacgttgtcagccttgcaggctatc
tacgagaagattggacctgtttctgtcattcattttgactcccacatcgacacctgggac
cccatggttctgggaggcaatgtctcttcatacatgcaggtcaaccatggcacctttttg
cattacgctgctgaacgaggctacctcaaccacggacacaacctacacgttggatctcgt
gctccctacgtgcgaaaacacggagatattgagcatgataagcactgcggctttgctatt
gtgaacgctcgagaaatcgacgaagtcggtatcgctggagttgttcagaagatcaaggac
cgggtcggaaacaccaacgtctatatttcggttgacattgatgttctcgatcccgtctac
gcacctggaactggtactgctgaacccggaggatacactactcgagaatttatgcagatt
ctcgatggccttgagggaatcaacattgttggagctgacgttgtggaagtggctcctgct
tacgatggtcctggtgacgttaccttgctggcagcagcacaagtgattgacagtctggca
tctctgatggtcatgaatggacccctttctactagacaaagcacaaagtaa

DBGET integrated database retrieval system