KEGG   Yarrowia lipolytica: YALI0E04675gHelp
Entry
YALI0E04675g      CDS       T01033                                 

Definition
YALI0E04675p
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
yli  Yarrowia lipolytica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:complement(529576..530985)
Genome map
AA seq 469 aa AA seqDB search
MALAEADLPNGKTNGKASGSEETPAPVQKVDMNVAINELRVGCKVHVEKDGEDRVAEILS
VQMRRGNLEFYVHYVEFNKRLDERIAATRVDLSQGVIWPEPEKPKKPLSGAAKESSKEKK
KNPSKKQKLTDSAATTPGANSEDVMDLDNLQVNGTTQDPDNFNRDEEIEKLRTGGSMTQS
SHEVARVRNLQRIVLGNHVIEPWYFSPYPIELTEEDEIYICDFTLCYFGSKKQFERFRSK
STLRHPPGNEIYRDEAVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMT
RRDEKGHHLVGYFSKEKESAEGYNVACILTLPQYQRHGYGRLLIDFSYALSKAEGKTGSP
EKPLSDLGLLSYRAYWADTIIELLMEKGKQEMTIEDIASVTAMTTTDVLHTLQTYNMLKY
YKGQHIICLTDSVCEKYEKMLKKRRRKVNSELLKWKPPVFTAAQLRFAW
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggctctcgcagaagcagacttgcccaacggcaaaaccaacggcaaagcctcggggtcc
gaggagactcctgcgcccgttcagaaggtcgacatgaacgtggcaatcaacgagctccgt
gtgggctgcaaagtccacgtcgagaaagacggtgaggaccgagttgctgaaattctcagc
gtgcaaatgagacgtggtaacctcgagttctatgtgcactacgtcgagttcaacaagcgt
ctggatgagcgtattgcggctactcgagtcgacttgtcacagggtgtcatttggcccgag
ccagagaagcccaagaagcctctcagtggtgctgcaaaggagagcagcaaggagaagaag
aagaacccctccaagaagcagaagctcacagattcggctgcaactactcctggagccaat
tcggaagatgtcatggacctggacaacctccaggttaacggcaccacccaggaccccgac
aatttcaaccgtgacgaggagattgagaagctcagaactggaggaagtatgacacagagc
agtcatgaggtggctcgagttcgaaatttacagagaattgttctaggcaatcatgtcatc
gaaccgtggtacttttctccctatcctatcgagctgaccgaagaagatgaaatctacatt
tgcgactttaccctgtgttatttcgggtccaagaagcagtttgagcggttcagatccaaa
tccactctgagacatcctcctgggaacgaaatctatcgagatgaggcagtcagtttcttc
gagattgacggcagaaagcagagaacatggtgccgaaacctgtgtctcctttcaaagctt
ttcctggatcataagactctctactacgatgtggaccccttccttttctactgcatgact
cgacgagatgagaagggtcaccatctggtaggatacttttccaaggagaaggagtctgct
gagggatacaatgtcgcttgtattctcacactgccgcaataccagcgtcacggttatggc
cgccttcttattgacttctcatatgccctttccaaggctgagggcaagactggttcccca
gaaaagcctctttcagatctgggtctgctgtcataccgagcctattgggcagacaccatt
attgagttgctcatggagaagggtaagcaggagatgacaatcgaagacattgcctccgtg
accgccatgaccactacagatgtgctgcataccctgcagacatacaacatgctcaagtac
tacaagggccaacacatcatttgtttgacagacagtgtgtgcgaaaagtatgaaaagatg
ctcaaaaagcggcgccgaaaggtcaactcggagctcctcaagtggaagccccccgtattc
acagctgcacagctgcggtttgcttggtaa

DBGET integrated database retrieval system