KEGG   Yarrowia lipolytica: YALI0E05929gHelp
Entry
YALI0E05929g      CDS       T01033                                 

Definition
YALI0E05929p
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
yli  Yarrowia lipolytica
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:yli00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:678546..680771
Genome map
AA seq 741 aa AA seqDB search
MAELRNRKGGVAAEPAAADSTPKVMVKPKKKSNAKYFQANLVLTLLAFLTRFIMLSHPDE
VVFDEVHFGKFASYYLQRTYFFDLHPPFAKLLIAAVGWLIGYDGSFKFENIGENYITNNV
PYVAYRALSASLGSLTVPIIFKTLQYSGYSVAACTIGAAIVCLDNAHINDSRLILLDATL
NISVALSLFCYVRFSNQRKSPFSLAWWTWLFSTGIALSCTISTKYVGVFTFMAVGGAVVY
DLWLLLDYEKSGLSMKDFLWHFGARAYALILVPFVIYLAWFQVHFVVLNRSGPGDAFMSP
DFQETLGDNFLAQQARDVEFYDIVRFKHKSTGALLHSHDARYPLRYEDGRISSQGQQVTG
YSTADPNNAWQILPEKDFPEDQRVGHPVYGSNKVRFRHLATNTYLLTHDVASPYFPTNQE
FTTVSPEVAAERYNETIFEVRLNTGKSNNVRTKAAEFKLIHDKTKVAMWSHSKLLPEWGF
GQFEINGNKNTQDPTNTWTFDEIVGLSPERAAFTPKKTRQIPFLQKYLELQGTMFRENNA
LTASHPYASEPITWPFLIRGVSFWTNAPNRAQIYFHGNFVGWYIEDIVIALFVGAIAADQ
FMRKRQITTFGRRASSKLYHSMGFFFLAWSTHFFPFFLMGRQKFLHHYLPAHLCAALLAG
AGFDFIFGEFDRLDEEANASKKDLEYTQRKNKPLHLATITVLILLTACFLFFCPLTYGLA
NQSVQAIQWRQWMKFELHFSK
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggcggaattgagaaatcgcaagggcggggtggctgccgagcctgcggcagccgactcc
acccccaaagtgatggtcaagcccaaaaagaagtccaatgccaagtacttccaggccaac
ctggtgctgactctgctggcgtttctgacccgattcatcatgctctcgcaccccgacgaa
gtggtgtttgacgaggtccactttggcaagtttgcctcctactacctccagcgaacctat
ttctttgatctccatcctcccttcgccaagctgcttattgctgctgttggctggctgatc
ggctacgacggatccttcaagtttgagaacattggcgagaactacatcaccaacaacgtt
ccctatgtcgcctaccgagcgctttcggcctccctgggctccctgaccgtccccattatc
ttcaagaccctccagtactctggctactccgtggctgcttgcaccattggagccgccatt
gtgtgtctggataacgcccatatcaacgactcgcgactgattctgctagatgccaccctc
aacatctccgtggccctgtcgctcttctgctacgtgcggttctccaaccagcgaaagtcc
cccttctctctagcctggtggacgtggctcttctccaccggtatcgccctctcctgcacc
atctccaccaagtatgtcggagtctttaccttcatggccgttggcggcgccgtcgtttac
gatctgtggctgctgctggattacgagaagtctggtctctcgatgaaggacttcctttgg
cactttggagctcgagcctacgctctcatccttgttccctttgttatctatctcgcctgg
ttccaggtccactttgtggttctgaaccgatctggccccggagacgctttcatgtcccct
gacttccaggagactctgggagataacttcctggcccagcaggcccgagacgtcgagttc
tacgacattgtgcggtttaaacacaagtcaaccggcgctctgctgcactcccacgatgcc
cgataccctctgcgatacgaggatggtcgaatttcgtcccagggccagcaggtgactgga
tactccactgctgatcctaacaatgcctggcagatcctccccgagaaagacttccccgag
gaccagcgagttggccaccctgtctacggatcgaacaaggtccgattccgacaccttgcc
accaacacctaccttctgacccacgacgtggcctctccttacttccccaccaaccaggag
ttcacgactgtgtctcccgaggttgctgccgagcgatacaacgagaccatcttcgaggtg
cgactcaacactggcaagtccaacaacgtgcgaaccaaggccgccgagttcaagctgatc
cacgacaagaccaaggtcgccatgtggtctcacagtaaactgctccccgagtggggcttt
ggccagtttgagatcaacggaaataagaatacccaggaccccactaacacctggaccttc
gacgagattgtcggtctgtctcctgagcgagcggccttcacccccaagaagacccgtcag
atccccttcctgcaaaagtaccttgagcttcagggaaccatgttccgagagaacaacgct
ctgaccgcctctcacccctacgcctccgagcccatcacttggcccttcctcattcgaggt
gtgtctttctggactaacgctcccaaccgagcccagatctacttccacggtaactttgtc
ggctggtacattgaggacattgtcattgctctgtttgttggcgcgattgctgccgaccag
tttatgcgaaaacgacagatcaccacctttggccgacgagcttcctcaaagctctaccac
tccatgggcttcttcttccttgcctggagcacacatttcttccccttcttcctcatgggt
cgacagaagttcctgcatcattaccttcccgctcatctgtgcgctgctctgcttgccggt
gccggcttcgatttcatctttggtgagttcgaccgactcgacgaggaggccaacgcttcc
aagaaggatctggagtacacccagcgaaagaacaagcctctccatttggccaccatcact
gttctcattctgctgaccgcctgcttcctcttcttctgccctctgacctacggactggct
aaccagagcgtccaggccattcaatggcgacagtggatgaagtttgagcttcatttcagc
aagtag

DBGET integrated database retrieval system