KEGG   Yarrowia lipolytica: YALI0E06919gHelp
Entry
YALI0E06919g      CDS       T01033                                 

Definition
YALI0E06919p
Orthology
K07204  
regulatory associated protein of mTOR
Organism
yli  Yarrowia lipolytica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:793596..797525
Genome map
AA seq 1309 aa AA seqDB search
MNGSVTSVQSVHSPQRRMEEDETVKSTASKTYVRHGFDDDYASDAYMSMLAEIFYIYLDD
KRHDTAGNPKRSSADGPPEWRMKDRQRTVSAAIVVCLNLGVDPPDVIKTDPCSRLEAWVD
PQTISDSKKATEQIGKQLQMQYEVLSMRTRYKQSLDPNVEDIKRFCIGLRRGAKEERILF
HYNGHGVPRPTASGEIWVFNRGYTQYIPVSLYDLQSWLGSPCIYVWDCHSAGNIVSNFKR
FVQQRIKEDADAQAPNGVTSAASGNGNAYLDCIQLAACRADETLPMHPDLPADLFTSCLT
SPIEIAVRWFVMKSPLAYGKKIKDLQIPGRITDRRTPLGELNWIFTAITDTIAWTLLPRD
LFKKLFRQDLMVAALFRNFLLADRIMRVNSCHPVSDPPLPPTHSHPMWDAWDLAVDQCLT
QLPALAAGQEYRHSQFFEEQLTAFEVWLRYNARSDNPPVQLPVVLQVLLSQVHRLRALIL
LSKFLDLGPWAVYSALSIGIFPYVLKLLQSPAKELKPVLVFIWARIMSVDHQSIQHELLK
DNGYAYFIQILLPFEGFAVNNVNVHDHRAMCSFIIALFCHGFKQGQRVSMGADLLRVLVV
YAAEPDSPLLRQWSCLCISQLWFDYLEGKWLGMKERVPQSLIVLLEDPVPEVRTACTVAL
TAFLGNGDADHISQDFKDVECELANAVLKLTDDASGIVRREAVVFFSRFVVQYQGQILVA
AFATLEQEAAAVSQMNLNTSSNPATGTVFAAVWEAVLTFAEDPFTEVRDFARDVVDHVLF
EMGQSPLGPRMEQLKRTMLQGAESKKQLPSVSNLIPSSESHHHAAGSPAPQSPAMAPLTP
TASSTIQNAIAADRAASSPLNSLKRSVSKYLFGDNEPSGTAAQKTDSSVTTVPFGTGTIP
VTPRYTSRAAGSRAQLPLKSGFFAWSTEFFQEPQMVPAEADCTGSQRYTERLWRKTRNER
IISESVLQRDEAVKGKWDHSLGVLSNKTQPQKLVFAQFEPHLAVADDRDGVSIWNWAENK
RLSRFCNANPAGTRITDVKYLNEDDVPMLLTASSEGCVRIYRHYESRQDVQLVSAWRALS
GVGLQASSPVAVDWQQSRGTLLVGGPTRVVKVWDAPREMCMASIPARSSAPVTALTSDQV
AGHMFVAGFADGALRLFDRRVDSRDAMVKIWKLSRGIRHSDKVLNVCMQRGGHRELVSGS
ADGVISTWDIRTDTPLRSWIAHTNGMKAMDVHEHAPVLVTGSQLVRTWDFDGHMTSVNKN
HPGYMTLPNRVTSVNALSFHPHRLVMASNNVNDGTVMLRSCSGFLKSDF
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atgaacggaagtgtgacatcggtgcaatcggtgcattcgccacaacgccggatggaagag
gatgagacggtcaagtccaccgcttccaaaacctatgtgcgccatggatttgacgacgac
tacgccagtgacgcctacatgtccatgttggccgaaatcttttacatctacctggacgac
aaacgccacgacactgcgggcaatccgaaacggtcttctgccgacggcccgcccgaatgg
cgcatgaaagaccgacagagaacagtgtctgcagccattgtggtgtgtctcaacctggga
gtggatcctccagatgtgatcaaaaccgacccctgctcgcgactggaggcctgggtggac
ccacagaccatctcagactccaagaaggccacggagcagattggaaaacagctacagatg
cagtacgaggtgctgtcaatgcgaacccggtataagcagtcgctggaccccaatgtggag
gacattaaacgattctgcataggactgcgacgaggtgctaaggaggagcgaattctgttt
cattacaatggccacggagtgcctcgacctacagcttcgggcgaaatctgggtcttcaac
agaggctacacacaatacattcctgtgtctttgtacgacctgcagtcgtggctgggctcg
ccatgcatctacgtgtgggattgccatagtgccggcaacattgtctctaacttcaagcgc
tttgttcagcagcgtatcaaggaggacgctgatgcacaagcacccaatggtgtgaccagt
gcagcttcaggaaacggaaatgcctacctcgattgcatccagcttgcagcctgccgggcc
gacgagactctgcccatgcacccagaccttccggcagatctgttcacgtcatgcctgacg
tccccaattgaaattgctgtgcgatggttcgtcatgaagtctcccttggcttacgggaag
aagatcaaggatctgcaaatcccaggaagaattaccgaccgaagaaccccccttggcgaa
cttaattggattttcactgccataaccgatacgatagcctggactttgttgcctcgcgac
ctgttcaaaaagctgtttcgacaggacctgatggtcgcagcgttgttccgaaactttctg
ctggcagacagaattatgcgggtcaactcatgccacccagtctcggaccctcctcttcct
cccacccattctcaccctatgtgggatgcgtgggatctagcagtcgatcagtgtctgact
cagttgcctgctttggctgctggacaggagtatcgccactcgcagttctttgaggaacaa
ctgacagcctttgaggtgtggctgcgatacaatgctcgaagtgataacccacctgttcag
cttcctgttgttttacaagtgctgttgtcacaggtccaccgactacgagcgctgatcttg
ctctccaagttcctcgatcttggaccctgggctgtctactcggcgctctctatcggtatc
ttcccctacgtgttaaagctgttgcagtcccccgctaaggagctaaaacccgtgcttgtt
ttcatctgggctcgaataatgagcgtggaccatcaatccattcagcacgagctgctcaag
gacaatggctacgcctacttcatccaaattcttctcccctttgaaggatttgccgttaac
aacgtgaacgtccatgaccacagagccatgtgttctttcatcatcgcactattctgccat
ggtttcaagcagggtcagcgggtctcaatgggtgctgatcttctccgggtgctcgtggtt
tacgcagctgagcctgactctccactgcttcgacagtggtcctgtttatgcatctcccaa
ctgtggttcgactacctagagggcaagtggcttggaatgaaggagagagtgccccagagc
ctcattgtgctgcttgaggatcctgttcctgaggtccgaacagcgtgtactgttgccttg
actgcattccttggcaatggagacgctgatcacatttcccaggatttcaaggacgtggaa
tgcgagcttgctaacgctgtcctcaagctgactgacgacgccagtggtattgttcgaaga
gaagcagtcgtattcttttcgcgtttcgtcgtccagtaccaaggtcagattctggttgct
gcgtttgctactctcgagcaagaagctgctgctgtctcccagatgaacctcaacacctcg
tccaatcctgccaccggtaccgtgtttgctgccgtgtgggaggccgttctgacatttgca
gaggacccgttcaccgaggtgcgtgactttgcacgtgacgtggttgatcacgtcttgttt
gagatgggccagtcgcctctgggacctcgaatggagcagctcaagcgaaccatgctgcag
ggagccgagtccaagaaacagctgcctagcgtttccaacctgattccttcgtcagagtca
catcatcatgctgctggtagtcctgctccccaatctcctgcgatggctcctctaacgcct
actgcatcttccaccattcaaaatgccattgctgccgacagggcagcttcttctcctctc
aactcgctcaagaggtctgtctcgaagtatctatttggagacaatgagcccagtggaaca
gcagcccagaaaacggactcatctgttacaactgttccttttggcacgggaaccatcccc
gtgacacctcgttacacatcgcgagctgcaggatcacgtgctcaactccctctgaagtcc
gggttttttgcttggtccacggagttcttccaagagcctcaaatggtgcctgcggaggcc
gactgtactggttcacagcggtacactgagagactgtggcgaaagacccgcaacgagaga
attatctccgagtcggtgcttcagcgagacgaagctgtcaagggcaagtgggatcactct
ctaggtgttctcagcaacaagacgcagcctcagaaactcgtttttgcgcagtttgagcca
catctggcagtagctgacgaccgagacggtgtttctatctggaactgggccgaaaacaag
cgtctgtcgcggttctgcaacgccaatcctgcaggaaccagaatcaccgacgtcaagtat
ctcaacgaagacgacgttcccatgctcctcacagcctcctccgagggatgtgtgcgaatc
tacaggcactacgagtcgcgtcaggatgtgcagttagtgtctgcttggagagctctttcg
ggagtcggtctgcaggcctcttctcccgtagctgtagattggcagcagtctcgaggaaca
ctgttggttggaggtcccacacgagtggttaaggtgtgggatgctccccgagagatgtgc
atggcttccattcctgctcggtcttctgcccctgtgactgccctcacctccgaccaggtt
gctggtcacatgtttgtggctggtttcgcggacggggctctgcgtctgtttgatcgacga
gtcgattctcgagacgccatggtcaaaatctggaagctatctcgaggtatcagacactct
gacaaggtgctcaacgtgtgcatgcaacgaggaggacaccgagagctggtatctggttcg
gcagacggagtcatcagtacatgggatatccgaacagacactcctctgcggtcttggatt
gcacacaccaacggcatgaaggccatggacgtgcatgaacatgcacctgtgttggttacg
ggctctcagttggtgcgaacgtgggactttgatggtcacatgacctcggtaaacaagaac
caccctggttatatgacccttcccaaccgggtaacctcggttaacgctttgtcgtttcat
cctcatcggctggtgatggcatctaacaatgtgaatgacggcactgtgatgttgagatcg
tgttcgggctttctcaagagtgatttctag

DBGET integrated database retrieval system