KEGG   Yarrowia lipolytica: YALI0E07535gHelp
Entry
YALI0E07535g      CDS       T01033                                 

Definition
(RefSeq) YALI0E07535p
  KO
K01476  arginase [EC:3.5.3.1]
Organism
yli  Yarrowia lipolytica
Pathway
yli00220  Arginine biosynthesis
yli00330  Arginine and proline metabolism
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
yli01130  Biosynthesis of antibiotics
yli01230  Biosynthesis of amino acids
Module
yli_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    YALI0E07535g
   00330 Arginine and proline metabolism
    YALI0E07535g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     YALI0E07535g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 2912445
NCBI-ProteinID: XP_503666
UniProt: Q6C6P6
Position
E:complement(858959..859891)
Genome map
AA seq 310 aa AA seqDB search
MNFEYFPERKLSIVSAPFSGGQPKGGVDKGPEYLLGGGLEKHLQSLDWDTKFDGHLEFPV
PESDEDIGKMKRPRYVAEASRRVYKAVSEAAVSGRFVLTIGGDHSIAVGTVAGVREKYPD
ACLIWVDAHCDLNTPAATDSGNLHGCPLSWVTGLAKPEKDDPFGWVPECLDFKNLAYIAL
RDVDDFEKKMIKEHGITAYSMHHVDKYGIGKVVEMALQKVNPDLSKPIHLSFDVDAMDPF
FAPSTGTPVRGGLTWREACYICEELAATGKLVAMDLVECNPALGASQKDIDDTISAGISL
AKSACGDTLL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaatacttccccgaacgaaagctcagcattgtctctgcccccttctccgga
ggccagcccaagggcggtgtcgacaagggccccgagtacctgctcggaggaggtctcgag
aagcacctccagagcctcgactgggacaccaaattcgacggacaccttgagttccccgtg
cccgagtctgacgaggacattggcaagatgaagcgaccccgttacgtcgctgaggcctct
cgacgggtctacaaggctgtttctgaggctgctgtctctggacggtttgtgctcaccatc
gggggtgaccactccatcgctgttggcactgttgccggtgtgcgagagaagtaccccgac
gcctgcctcatctgggtcgatgctcattgcgatcttaacactcccgccgctaccgactct
ggcaacctgcacggctgtcctctgtcgtgggtcaccgggctcgccaagcccgagaaggac
gatcccttcggatgggtccccgagtgtctcgacttcaagaacctcgcctacattgcgctg
cgagacgtggacgactttgagaagaagatgatcaaggaacatggcatcaccgcctactcc
atgcaccatgtggacaagtacggcattggaaaggtggtcgagatggctctgcagaaggtc
aaccccgatctcagcaaacccattcacctctccttcgacgttgacgccatggaccccttc
tttgctccctccactggaactcctgttcgaggaggtctcacctggcgagaggcctgctac
atctgcgaggagcttgctgccaccggaaagctcgtcgccatggacctcgtcgagtgcaac
cccgctcttggtgcttctcagaaggatattgacgacaccatcagcgctggcatttccctc
gccaagagtgcttgcggagatactcttctgtaa

DBGET integrated database retrieval system