KEGG   Yarrowia lipolytica: YALI0E07535gHelp
Entry
YALI0E07535g      CDS       T01033                                 

Definition
YALI0E07535p
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
yli  Yarrowia lipolytica
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:yli01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:yli00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:complement(858959..859891)
Genome map
AA seq 310 aa AA seqDB search
MNFEYFPERKLSIVSAPFSGGQPKGGVDKGPEYLLGGGLEKHLQSLDWDTKFDGHLEFPV
PESDEDIGKMKRPRYVAEASRRVYKAVSEAAVSGRFVLTIGGDHSIAVGTVAGVREKYPD
ACLIWVDAHCDLNTPAATDSGNLHGCPLSWVTGLAKPEKDDPFGWVPECLDFKNLAYIAL
RDVDDFEKKMIKEHGITAYSMHHVDKYGIGKVVEMALQKVNPDLSKPIHLSFDVDAMDPF
FAPSTGTPVRGGLTWREACYICEELAATGKLVAMDLVECNPALGASQKDIDDTISAGISL
AKSACGDTLL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaatacttccccgaacgaaagctcagcattgtctctgcccccttctccgga
ggccagcccaagggcggtgtcgacaagggccccgagtacctgctcggaggaggtctcgag
aagcacctccagagcctcgactgggacaccaaattcgacggacaccttgagttccccgtg
cccgagtctgacgaggacattggcaagatgaagcgaccccgttacgtcgctgaggcctct
cgacgggtctacaaggctgtttctgaggctgctgtctctggacggtttgtgctcaccatc
gggggtgaccactccatcgctgttggcactgttgccggtgtgcgagagaagtaccccgac
gcctgcctcatctgggtcgatgctcattgcgatcttaacactcccgccgctaccgactct
ggcaacctgcacggctgtcctctgtcgtgggtcaccgggctcgccaagcccgagaaggac
gatcccttcggatgggtccccgagtgtctcgacttcaagaacctcgcctacattgcgctg
cgagacgtggacgactttgagaagaagatgatcaaggaacatggcatcaccgcctactcc
atgcaccatgtggacaagtacggcattggaaaggtggtcgagatggctctgcagaaggtc
aaccccgatctcagcaaacccattcacctctccttcgacgttgacgccatggaccccttc
tttgctccctccactggaactcctgttcgaggaggtctcacctggcgagaggcctgctac
atctgcgaggagcttgctgccaccggaaagctcgtcgccatggacctcgtcgagtgcaac
cccgctcttggtgcttctcagaaggatattgacgacaccatcagcgctggcatttccctc
gccaagagtgcttgcggagatactcttctgtaa

DBGET integrated database retrieval system