KEGG   Yarrowia lipolytica: YALI0E09493gHelp
Entry
YALI0E09493g      CDS       T01033                                 

Definition
YALI0E09493p
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
yli  Yarrowia lipolytica
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:yli00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:yli00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:complement(1145093..1151653)
Genome map
AA seq 2186 aa AA seqDB search
MTPSLPIFPPLNPEDKLMTLELQDGTAVQGYSFGADKPVAGELVFQTGMVGYPESITDPS
YQGQILIVTFPLVGNYGVPSREAVDEVVKGLPKHFESNKIHVAGLVVASYTEEYSHFLAE
SSLGAWLKEQDIPAIYGVDTRRMTKHIREEGSMLGRLCIDNAVPEWVDPNKLNLVAEVSI
KEPKLYTPPADRAIHVNGKPVRILAVDVGMKYNQIRCFVNRGVELLVVPYDYDFLNEEYD
GLFLSNGPGDPSVLKETAARIAKAVEAKKTPIFGICLGHQLLSRSTGATTLKMKFGNRGH
NIPCTNLLSGRCYITSQNHGYAVDAKSLTGGWEELFVNSNDGSNEGIYHKDLPFFSVQFH
PESTPGPRDTEFLFDVFIKAVVEHKTSGVLKAIEFPGGTIEENRAAHPRVQVKKVLVLGS
GGLSIGQAGEFDYSGSQAIKALKEEGIYTVLINPNIATIQTSKGLADKVYFLPVTPEFVR
KVIKYERPDAIYVTFGGQTALNVGIEMKDEFEGLGVKVLGTPIDTVITTEDRELFARSME
EIGEKCAKSATASSKEEALAVVEEIGYPVIVRAAYALGGLGSGFADNEAELIELCNKAFA
GSPQILVERSMKGWKEIEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDE
DYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPLA
FIAAKLGLNIPLNEIRNSVTQVTCACFEPSLDYVVVKIPRWDLKKFTRVSTLLSSAMKSV
GEVMSIGRTFEEAIQKAIRSTDYQNLGFNETEALMSIDIDSELQTPSDQRLFAIANALHS
GYTVDKIWELTNIDKWFLNKLDGLVKFAKGLTKYNNSNLPVNIMREAKQLGFDDRQIAKY
TGSNELAVRLKRVEAGVTPFVKQIDTVAAEFPAFTNYLYMTYNADSHDLTFDDHGTMVLG
SGVYRIGSSVEFDWCAVRAVRTLREQGAKTIMVNYNPETVSTDYDEADRLYFEVINMERI
LDIYELERSSGVVISMGGQTSNNIALQLYRQNVNILGTSPEMIDSAENRYKFSRMLDTIE
VDQPAWKELTSIDEAEAFAEKVSYPVLVRPSYVLSGAAMNTVYTRDDLASYLNQAVEVSR
DYPVVITKYIENAKEIEMDAVAKDGKLIMHVVSEHVENAGVHSGDATLIVPPQDLDPETV
RRIVVATAKIGKALQVTGPFNIQFIAKDNEIKVIECNVRASRSFPFVSKVTGVDLIEMAT
KAICGFPVSPYPLEELPQDFVAVKVPQFSFSRLSGADPILGVEMASTGEVATFGKNKYEA
YLKALLATGFKLPKKNILLSVGSYKEKVELMPSIKRLHELGFKLFATAGTADFIQEHGVP
VQYLDVLNEGADEEKSEYSLTQHLANNMIDLYINLPSSNRFRRPANYMSKGYRTRRLAVD
YAVPLVTNVKNAKLLTEALARNMTLDVSATDFQSSHNTVTLPGLVNVAGVVPDIAIAGSS
DIADFTKVSLRSGFTFSRLLPMGVSESIIDLASLQTAQANAEGHSFTDYNLSVAATAHNA
NEVGKVTGKVGSLVLPFSKLGDNTTKVAAISEHFGAWPANKPIVTDATTTDLASILLLAS
LHNRPIHVTGVVDKNDIVLVAMAKERGLAVTCDVSVFALFFAREDYPEAHSLPTQEDQDA
LWANLATIDCFSVGILPSQMAKELGQPVVAGLGVAETLPLLLSAVADKRLTVEDIEARLY
TNPVRIFELVEQPDTSIVVNLGRKYTFKSKGLWSPMAGKPATGSVERVIVGGQTVVLEGD
LNGASTGKAISIHPQAAPVEAAPATQEMVHSPTTPRMARFSFSSDVRPFANNHVESSVVG
AIPPEVSAPSILNKLRRNPFLGQHILSVNQFSKENLHDIFALANELRQAVKRVGVLDILK
GRLLTTLFYEPSTRTATSFDAAMQRLGGRVIAVNVDASSYKKGETLQDTLRSVACYSDAI
ALRHPDPESANIAGRFSPVPVINGGNGSVEHPTQALLDMYTIREEVGTLNGTTITFMGDL
RYGRTVHSLVRLLTHYKVNIRLVCPPELTLPDELKTLLKSQGKLDLESATLTPEIVSTTD
VLYCTRVQKERFTNEKEFEAIKESYLVDNKVLKDAKPHMCVMHPLPRNAEINPEVDFDAR
AAYFRQMRHGLFVRMALLAMVMGPVQ
NT seq 6561 nt NT seq  +upstreamnt  +downstreamnt
atgaccccctcgcttcccatcttcccccccctcaaccccgaggacaagctcatgaccctg
gagcttcaagacggcactgccgttcagggttactctttcggagccgacaagcctgtggcg
ggcgagctcgtgttccaaaccggtatggtgggctatcccgagtccatcaccgatccctcc
taccagggtcagattctgattgtcaccttccccctggtcggcaactacggtgtcccctct
cgagaggccgtggacgaagtggtcaagggcctccccaagcactttgagagcaacaagatc
catgtggcgggtcttgttgttgcctcgtacaccgaggagtactcgcacttcctggccgaa
tcttctctcggtgcctggctcaaggagcaggacattcctgccatctacggcgtcgacacc
cgacgaatgaccaagcacatccgagaggagggttccatgctcggacgactgtgcattgac
aacgcggtccctgagtgggtcgaccctaacaagctcaacctggtcgccgaggtttccatc
aaggagcccaagctctacacccctcctgctgaccgagctattcacgtcaacggcaagcct
gttcgaatcctggctgtcgacgttggtatgaagtacaaccagatccgatgctttgtcaac
cgaggcgtcgagcttctggtcgtcccttacgactacgacttcctcaacgaggagtacgac
ggtctcttcctctccaacggtcccggagatccctccgtgctcaaggaaaccgccgctcga
atcgccaaggccgtcgaggccaagaagacccccatctttggtatctgtcttggtcaccag
ctgctttctcgatctaccggcgccaccactctcaagatgaagttcggtaaccgaggacac
aacattccctgcaccaacttgctgtctggtcgatgctacatcacctcgcagaaccacggt
tacgctgtggacgccaagtctctgactggcggctgggaggagctttttgtcaactccaac
gacggctccaacgagggtatctatcacaaggacctgcccttcttctcggtgcagttccac
cccgagtccacccccggtccccgagacaccgagttcctgtttgacgttttcatcaaggct
gtcgtcgagcacaagacctctggtgttctcaaggccatcgagttccccggtggcaccatt
gaggagaaccgagccgctcacccccgagtgcaggtcaagaaggtgcttgttttgggctct
ggaggtctctccattggccaggctggtgagttcgactactccggttctcaggccatcaag
gctctcaaggaggagggcatctacaccgtgcttatcaaccccaacattgccaccatccaa
acctccaagggtctggccgacaaggtgtacttcctgcctgtgacccccgagtttgtgcga
aaggtgatcaagtacgagcgccccgacgccatctacgtcacctttggtggccagaccgct
ctcaacgttggtatcgagatgaaggacgagtttgagggtctcggtgtcaaggtgctcggt
acccccatcgacaccgtcatcaccaccgaggaccgagagctgtttgcccgatccatggag
gagattggcgagaagtgcgccaagtcggccactgcttcttccaaggaagaggctcttgct
gtcgttgaggagattggctaccctgttatcgttcgagctgcctacgctcttggtggtcta
ggttccggttttgccgacaacgaagccgagctgatcgagctgtgtaacaaggcgtttgcc
ggctcacctcagatcctggtcgagcgatccatgaagggctggaaggagattgagtacgag
gttgttcgagatgcctttgacaactgtatcactgtgtgtaacatggagaacttcgaccct
ctcggtatccacactggtgactccatcgtcgtggccccctctcagaccctgtctgatgag
gactacaacatgctgcgaaccaccgctgtcaacgtcatccgacatctcggtgtggttggt
gagtgtaacatccagtacgccctcaaccccttcagcaaggagtattgcatcattgaggtc
aacgcccgtctgtctcgatcttctgccctggcttccaaggccaccggctaccccctggca
ttcatcgctgccaagcttggtctcaacattcccctgaacgagattcgaaactccgtcacc
caggtcacctgtgcctgtttcgagccctctctggattatgttgttgtcaagattcctcga
tgggatctcaagaaattcacccgtgtgtctactctgctgtcttccgccatgaagtccgtc
ggagaggtcatgtctatcggtcgaacctttgaggaggccatccagaaggccatccggtcc
actgactaccagaacctgggtttcaacgagaccgaggctctcatgtcgatcgacattgac
tccgagctgcagactccttctgatcagcgactgttcgcaattgccaacgctctgcactct
ggttacaccgtggacaagatctgggagctcaccaacatcgacaagtggttccttaacaag
ctggacggtctggtcaagttcgccaagggcctgaccaagtacaacaactccaacctgcct
gtcaacatcatgcgagaggccaagcagctgggtttcgacgatcgacagattgccaagtac
accggctccaacgagctggctgtgcgtctcaagcgagtcgaggctggtgtcacccctttc
gtcaagcagattgataccgttgctgctgagttccccgccttcaccaactacctttacatg
acctacaacgctgactcccacgatctgacctttgacgatcacggcaccatggtccttggt
tctggtgtctaccgaatcggctcttccgtcgagtttgactggtgtgctgttcgagccgtc
cgaactcttcgagaacagggcgccaaaaccatcatggtcaactacaaccccgagactgtg
tctaccgactacgacgaggccgaccgactctactttgaggtcatcaacatggagcgaatc
ctcgacatttacgagctggagcgatcctccggtgtcgtcatctccatgggtggtcagacc
tccaacaacattgctctgcagctgtaccgacagaacgtcaacattctcggtacttctcct
gagatgatcgactctgccgagaaccgatacaagttctcccgaatgctggacaccattgag
gttgaccagcctgcctggaaggagttgacctccatcgacgaggccgaggcctttgccgag
aaggtctcttaccctgtgcttgtgcgaccttcttacgtgctttctggtgccgccatgaac
accgtctacacccgagacgatctggcctcttacctcaaccaggctgtcgaagtgtctcga
gactaccctgtcgtcatcaccaagtacattgagaacgccaaggagattgagatggacgct
gttgccaaggacggtaagctcatcatgcacgttgtttccgagcacgttgagaacgctggt
gtgcactctggagatgccactctgattgtgcctccccaggatctcgatcccgagactgtc
cgacgtattgtcgtggccaccgccaagattggtaaggctctgcaggtgactggtcccttc
aacattcagttcattgccaaggacaacgaaatcaaggtcattgagtgcaacgtgcgagcc
tctcgatctttccccttcgtgtccaaggtgaccggtgttgatctcattgagatggccacc
aaggctatctgcggtttcccagtctctccttaccccctggaggagctcccccaggacttt
gtcgccgtcaaggtgccccagttctccttctctcgactgtctggagctgaccccatcctc
ggtgtcgagatggcctccactggtgaggttgctacctttggcaagaacaagtacgaagcc
tacctcaaggctctgcttgccactggcttcaagctgcccaagaagaacattcttctgtcc
gttggttcttacaaggagaaggttgagctgatgccctccatcaagcgactccacgagctc
ggcttcaagctgtttgccactgccggtacagccgacttcatccaggagcacggcgttccc
gtccagtacctcgatgtcctcaacgagggtgctgacgaggagaagtctgagtactcgctg
actcagcacctggccaacaacatgatcgacctatacatcaacctgccctcttccaaccgg
ttccgacgacccgccaactacatgtccaagggttaccgaactcgacgtctggctgttgac
tacgccgttcctctggtgaccaacgtcaagaacgccaagttgctgaccgaggctctggct
cgaaacatgactctggacgtgtccgccaccgacttccagtcgtctcacaacactgtgact
cttcctggtctggtcaacgtggccggtgtggttcccgacattgccattgctggctcttcc
gacattgccgacttcaccaaggtgtctctgcgatctggcttcaccttctctcgactgctc
cccatgggcgtgtccgagtccatcatcgatctggcttcgcttcagactgctcaggctaac
gccgagggccactccttcacagactataacctttctgtggctgccactgctcacaatgcc
aacgaggttggtaaggtgaccggcaaggttggttctctggtgctgcccttcagcaagctg
ggcgacaacaccaccaaggtggctgccatctcggagcactttggcgcctggcccgccaac
aagcccattgtcactgacgccaccaccaccgacctggcctccattctgctgctggcttcc
ctgcacaaccggcccatccacgtgaccggcgttgttgacaagaacgacattgtgctggtt
gccatggccaaggagcgaggtctggctgtcacctgtgacgtgtccgtctttgccctcttc
tttgcccgagaggactaccccgaggcccactctctgcccacccaggaggaccaggatgct
ctgtgggccaaccttgccaccatcgactgcttctccgtcggcattctgccttctcagatg
gccaaggagctcggccagcccgttgtcgctggtcttggtgttgccgagaccctgcctctg
ctgctctctgccgtggctgacaagcgtctcaccgtcgaggacattgaggctcggctctac
accaaccccgttcgaatcttcgagctggtggagcagcccgacacctccattgtcgtcaac
ctcggccgaaagtacactttcaagtccaagggtctgtggtctcccatggccggcaagcct
gccactggctccgttgagcgagtcattgtcggcggacagactgttgtccttgagggtgac
ctcaacggtgcttccaccggcaaggccatctccatccacccccaggctgctcccgttgag
gctgctcctgccacccaggagatggtgcactcccccaccaccccccgaatggcccgattc
tcattctcctccgacgttcgacccttcgctaacaaccacgttgagtcgtctgttgtcggt
gccatcccccccgaggtttccgctccttccattctcaacaagctgcgacgaaaccccttc
cttggtcagcacattctctctgtcaaccagttctccaaggagaacctgcacgacattttt
gctctggccaacgagctgcgacaggctgtcaagcgagtcggtgttctggacatcctcaag
ggtcgtctgctgaccaccctcttctacgagccttccacccgaaccgccacttcctttgat
gccgccatgcagcgacttggaggccgtgtcattgccgtcaacgtcgacgcctcctcctac
aagaagggcgagaccctgcaggacactctccgatctgttgcttgctactcggacgccatc
gctctgcgacaccccgaccccgagtctgccaacatcgccggccgattctctcctgtcccc
gtcatcaacggtggcaatggatccgtcgagcaccccacccaggctcttctcgacatgtac
accatccgagaggaggttggtactctcaacggcaccaccatcaccttcatgggtgatctg
cggtacggccgaaccgtgcactctctggtgcgtctgctgacccactacaaggtcaacatt
cgactggtgtgtccccccgagctcactctgcccgacgagctcaagactcttctcaagtct
cagggcaagctcgatcttgagtccgccacgctcacccccgagattgtctccacgactgat
gttctctactgcactcgagtacagaaggagcgattcactaacgagaaggagtttgaggcc
atcaaggagtcgtacttggtcgacaacaaggtgctcaaggacgccaagccccacatgtgt
gtcatgcatcctctgcctcgaaatgccgaaatcaaccccgaggtcgactttgatgcccga
gccgcctacttccgacagatgcgacacggactctttgtccgaatggctctgctcgccatg
gtcatgggtcctgttcagtaa

DBGET integrated database retrieval system