KEGG   Yarrowia lipolytica: YALI0E15081gHelp
Entry
YALI0E15081g      CDS       T01033                                 

Definition
YALI0E15081p
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
yli  Yarrowia lipolytica
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    YALI0E15081g
Enzymes [BR:yli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     YALI0E15081g
Glycosyltransferases [BR:yli01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   YALI0E15081g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:complement(1797563..1800016)
Genome map
AA seq 817 aa AA seqDB search
MSKGEKKTVQAVYAKSALEEMAPEVTPAPGYKNLSEERALTPKDRVLIFVVSFLAGYTRF
RNIWQPSSVVFDEVHFGGFARKYVIGRFFMDVHPPLAKMLFAAVGWLAGYDGEFEFSSIG
VDYLSSNVPYVAMRSYPAVLGVATVALAYLTLKASGCRTATCFFGAALLAIENSLVTESR
YILLDSPLIFFLALTVYFFKKFELETPFTGAWYRYLFLSGLALGATTSVKWYGLFTIAWM
GLMTLWHLWWTLGDLSVTPCSFTRHFGWRAAFLIGVPISFYVAMFAVHFLCLVNTGDGAS
FMSPEFQNTLQHSTLIGNQPADVLLGSKITLRHLNTQGGYLHSHESLYETGSKQQQVTLY
PHSDQNNDFLVENYTVTEGDFQGDQIFLKDGDVIRLKHIATGRRIHSHDFRPPVSEADYQ
NEVSAYGYPGFDGDANDNFRVEIVKSKSQKGVSRDRVRTIDTKFRLIHTITGCALFSHSV
KLPKWAFEQQEVTCAKSGTLPNSIWYIESNSHPTLVDSTDRASYRTPSFLSKFLELNKVM
WTVNKGLTDPHTWESRPESWPFLQRGINFWVKDNRQVYLLGNAPIWWLTTLSIGIFLLWK
AINLLRFQRGYNDFAGRPDLRAYDVQFTSFLLGWALHYFPSYLMARQLFLHHYLCSLYFV
FLGFVCSWEYFTLRIVRNKIIGGALSVGVFAAALSFYVYYSPIIYGDPWTKSLCEKGKWL
PGWDFDCNSFHESLDLYNEASILPVDEKVVDSVLDHSIAEAVEDAAEAVKASEAHISPHA
APPNQKVVYKDEEGNVLDPEEVAKMAEQGKVEFRKGE
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaggtgaaaagaagacggtacaagccgtgtacgccaaatcggccctcgaggag
atggctcctgaggtcactccggcccccggatacaagaacctgtctgaggaacgcgctctg
acacccaaggatcgagtgctcatcttcgtggtctctttccttgccggttacaccagattc
cgaaacatctggcagccctccagtgtggtcttcgacgaagtccactttggtggttttgcc
cgaaaatacgtcattggacggttcttcatggatgtccaccctcctcttgctaagatgctc
ttcgctgctgtcggctggctggctggctatgacggcgagtttgaattctcctccattggt
gttgactacctgtcctccaacgttccctatgttgccatgcgatcctaccctgctgttctc
ggtgtcgcaaccgtggccctcgcatacctgaccctcaaggcttccggctgcagaaccgcc
acttgcttctttggtgctgctctgcttgccattgagaactctcttgtcactgaatcgcgg
tacattctgcttgattcgccccttatcttcttcctggctctcaccgtgtacttcttcaag
aagtttgagctcgagacccccttcaccggcgcctggtaccgatacttgttcctgtctgga
ctggctctcggtgctaccacctctgttaagtggtacggtcttttcaccatcgcctggatg
ggtctcatgactctgtggcacctgtggtggacccttggtgatctcagtgtcaccccctgc
tcctttactcgacacttcggctggagagctgccttcctcattggtgtccccatttccttc
tacgttgcaatgtttgccgtgcacttcctgtgccttgtcaacactggtgatggagcttct
ttcatgtcccccgagttccaaaacaccctgcagcactccactcttattggaaaccagccc
gctgatgttcttctcggatctaagatcaccttgcgacacctcaacacgcagggcggttac
ctgcactctcacgagtccctctacgagactggctccaagcagcagcaggtcactctctac
cctcactctgaccagaacaacgatttcctagttgaaaactacactgtgactgagggtgac
ttccagggtgaccagatcttccttaaggacggtgatgtcattcgactcaagcacattgct
actggccgacgaatccactctcacgatttccgaccccccgtgtctgaggctgactaccag
aacgaggtttccgcctacggttaccccggtttcgatggtgatgccaatgataacttccga
gtcgagattgtcaagtccaagtcccagaagggtgtctctcgggaccgtgttcgaaccatc
gacaccaagttcagacttatccacaccatcactggttgtgctttgttctctcactctgtc
aagctccccaagtgggcctttgagcagcaggaggtaacttgcgccaagtctggaactctt
cccaactccatctggtacattgagtctaactcccaccccactctcgtggattccactgac
cgagcctcttaccgaaccccctctttcctgtccaagttcctcgagctgaacaaggtcatg
tggactgtcaacaagggacttactgatccccatacctgggagtctcgacctgagtcctgg
cccttcctccaacgaggtatcaacttctgggttaaggataaccgacaggtctaccttctc
ggtaacgctcccatctggtggttgactaccctctctattggtatcttcctcttgtggaag
gccatcaatctgctgcgattccagcgcggatacaacgactttgcaggccgacctgatctg
cgagcttacgacgtccagttcacctccttccttcttggatgggctctgcactacttcccc
tcttacctcatggctcgacagctcttcctgcaccactacctgtgctctctctactttgtt
ttccttggttttgtctgctcttgggagtacttcaccctccgaattgtgcgaaacaagatt
attggaggtgctctcagtgttggtgtctttgctgccgccctctctttctacgtctactac
tctcccatcatttacggagacccatggaccaagtctctgtgtgagaagggcaagtggctt
cctggctgggatttcgactgtaactctttccacgagtcccttgacctttacaacgaggct
tccattctgcccgttgatgagaaggttgttgactctgtcctcgaccactctatcgccgag
gccgttgaggatgccgctgaggctgtgaaggcctctgaggctcacatttctcctcatgcc
gctccccctaaccagaaggtggtttacaaggatgaggagggcaatgttcttgaccccgag
gaggtcgccaagatggctgagcagggcaaggtggagttccgaaagggcgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system