KEGG   Yarrowia lipolytica: YALI0E16060gHelp
Entry
YALI0E16060g      CDS       T01033                                 

Definition
YALI0E16060p
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
yli  Yarrowia lipolytica
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YALI0E16060g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YALI0E16060g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:1913947..1915863
Genome map
AA seq 638 aa AA seqDB search
MKFSPLLLATVGLAQSFYSPTDSYAPGSVDCPSNSTQIVRKGEGLSSQEREWVQNRHEQT
RPELLNYLKRVGFKSVDPDQFLGQDTNITIGLSFSGGGYRAMLAGAGQFAALDARTPNAT
EPGHVGGLVQAATYLVGLSGGNWMVGSVVINNFTTIPDLQHSSDVWDLEHSMINPGGINI
FKTGSYWDDINDDVNDKQHAGYNTSFTDIWGRGLSYQFFNASNTARLTWSEIQNYDHFKN
HSMPYPIVVADGRAPGTRIISGNSTIFELAPFEVGSWDPNVYSFAKTEWLGTNMTNGRPN
GTCVHGFDNAGFIVGTSSSLFNQFILQLNSTGVTGVVYDLAHSILKRLDKDSDDIAIYSP
NPFKGMSYLGNSSIAQTEYLDLVDGGEDGQNVPYYPLLQPERAVDVVISYDNSADTDFNW
PNGTSAVQTYRRQFENQANGTIFPYVPDVNTFINENLTSRPAFFGCDVQNMTSLDKNGYT
DVNSSAALPPLIVYIANYPWTFFSNTSTMSKLSYNKKEVAGMIENGYSTSTQFNGTVDPD
WPVCLGCALLKREATRRNQSLGSDCDKCFSKYCWNGKTDDDAEKALKFAPAIYANGPNVS
SNASIGQASSTSKPKKNGAEGLVPGMAAIAIGFAALLM
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaaattctctccacttttgctggcgaccgtgggtctggcccagagcttctattcgccc
accgactcgtacgcgcccgggtcggtcgactgtccctccaactccacccagattgtgcga
aagggcgagggcctttcttcgcaggaacgagagtgggtccagaaccgacacgaacagacc
cgaccggagctgctcaactacctgaaacgggtgggctttaagtcggtggacccggaccag
ttcctgggccaggacactaatatcaccatcggactgtccttttctggaggaggatacaga
gccatgttggcgggagcaggccaatttgcggctctggacgcgcgaacacccaacgccacc
gaaccgggccatgtgggaggtctggtccaggccgccacctatctggtgggtctttcgggc
ggaaactggatggtgggatctgtggtcatcaacaacttcaccaccattcccgacctgcaa
cactcgtccgacgtgtgggacctggaacactccatgatcaaccccggcggaatcaacatc
ttcaagaccggctcttattgggacgacatcaacgacgacgtcaacgacaagcagcacgcc
ggatacaacacctctttcaccgacatctggggccgaggtctgtcgtaccagttcttcaac
gcttccaacaccgcccgactcacctggtccgagatccagaactacgaccacttcaagaac
cactctatgccctaccccattgttgtggccgacggccgagcccccggaacccgaatcatc
tccggaaactccaccattttcgagctggccccgttcgaggtcggctcctgggaccccaat
gtctactcctttgccaagaccgagtggctgggaaccaacatgaccaacggccgacccaac
ggaacctgtgtgcatggctttgacaacgccggtttcattgtgggaacctcttcttccctg
ttcaaccagttcattctccagctcaactccaccggagtaaccggagtggtctacgacctg
gcccactctatcctcaagcgtctggataaggactcggacgatatcgccatctactcgccc
aaccccttcaagggcatgtcctacctcggcaactcgtccattgcccaaaccgagtatctg
gatctggtcgacggaggagaagatggacagaatgtgccctactaccctctgctgcagccc
gagagagccgtcgacgtggtcatctcctacgacaactccgccgacaccgactttaactgg
cccaacggaacctccgctgtccagacataccgacgacagtttgagaaccaggccaatggc
accattttcccctacgtgcccgacgtgaacacattcatcaatgagaacctgacttctcga
cccgccttctttggctgtgacgtgcagaacatgacctcgctggacaagaacggttatacc
gacgtcaactcttccgccgcccttccccctctcattgtctacattgctaactacccctgg
acctttttctccaacacatcgaccatgtccaagctgtcgtacaacaagaaggaggttgcc
ggcatgatcgagaacggctactccacctccacccagttcaacggaaccgtggaccccgac
tggcctgtgtgtcttggctgtgctctgctcaagcgagaggccacccgacgaaaccagtct
ctgggctctgactgtgacaagtgcttctccaagtactgctggaacggaaagactgacgat
gatgccgaaaaggctctgaagtttgctcccgccatctatgccaacggccctaacgtttct
tccaacgcctcaattggccaggcttcgtccacctccaagcccaagaagaacggcgccgag
ggtctggttccgggtatggctgccattgccattggttttgccgctcttcttatgtaa

DBGET integrated database retrieval system