KEGG   Yarrowia lipolytica: YALI0E16907gHelp
Entry
YALI0E16907g      CDS       T01033                                 

Definition
YALI0E16907p
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
yli  Yarrowia lipolytica
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YALI0E16907g
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     YALI0E16907g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:2003914..2005614
Genome map
AA seq 566 aa AA seqDB search
MAPQPDQSSMFVTSPQTQPDDSPLMTPLAVPQHAGLSQAISKLSLNTKAPGTVEKPVRPP
LATRVSGPHIKLRRFSGTKSEHSSAGEEDLPPPNVNFFLDNRLPTEYFKQDILMLIHTLK
IPKWKYVESTMAADMVVTRLSGALTNAVYHVAPPTYLKERLREANEGFVAKHRLPLPLLL
RVYGPQVEHLIDRDSELRILQRLGRKNIGPKMMGTFTNGRFEQFFHAKTLSKEDLRDPDT
SVQIAKRMRELHDHVRLLPEERMSGPGVWVNFEKWGVRAKEVLEILDNRAKTNPAAEWTC
QTVVQSSWDEFLTMVAKYRSWLEHKHGGAESINKKLVFAHNDTQYGNLLRLEPPPGSPLL
QPQLEHRQLIVIDFEYASPNARGFDICNHFCEWMSDYHDAQHPETIHEKAYPTVKEQLNL
LNGYVEHGLESFDDEDQIQVEVDGLMEEVRDWRPAVHLYWLVWGIVQAVIDQEEDDEIRE
ELNMETGQYTFETEEEKQQLSASSGSSANLKPSVSHSSASEVEEEEDPFDYLSYASQKAQ
LFWSDMIRFGLLDEKDYKGVTRFINA
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggcccctcaacccgaccaaagctccatgtttgtcacctctccacagacccagccggac
gacagtccgctgatgacgccgctggcggtcccccagcacgcgggactcagccaggcgatt
tccaagctcagtctcaacaccaaggcccccggcaccgtcgagaagcccgtgcgacctccg
ctggcgacgcgggtgtcgggtccacacattaagctgcgacggttttcgggcaccaagagc
gagcactcgtctgccggcgaggaggatctacccccgccaaacgtgaattttttcctcgat
aaccgactccccacggagtacttcaagcaggatatcctcatgttgatccataccctcaag
attcccaagtggaagtacgtggagagcaccatggccgccgacatggtggtcacccgactg
tctggtgcgctcaccaacgccgtctaccacgttgctcccccgacatacctcaaggagcgg
ctgcgagaagccaacgaaggctttgtggccaaacacaggctgccgctgcctctgctgcta
cgagtgtacggcccccaggttgagcatctcatcgaccgggactcggagctgcgaattctg
cagcgtctgggacgaaagaacattggacccaagatgatgggcacctttaccaacggccgg
ttcgagcagttcttccacgcaaagaccctgtccaaggaagatctcagagacccagacact
tctgtgcagattgccaagcgaatgcgagagctgcacgaccacgtgcgactgcttcctgaa
gagcgaatgtctggccccggagtgtgggtcaactttgaaaagtggggcgtgcgagccaag
gaggtgcttgagattctcgataaccgggccaagaccaaccctgccgccgaatggacttgc
cagaccgttgtgcagagctcctgggacgaattcctgaccatggttgccaagtaccgaagc
tggctggagcacaagcatggaggcgccgagtccatcaacaagaagctcgtctttgcccac
aacgatacacagtacggcaatctgctgcgtctggagcccccgccaggctctcctctgctg
caacctcagctggagcacagacagctcattgtcattgactttgagtacgcatcccccaac
gcccgaggctttgatatctgtaaccacttttgcgagtggatgtccgactaccacgatgct
cagcatcccgaaaccattcatgagaaggcctatcctaccgtcaaggagcagctcaacctt
ctcaacggctacgtggagcatggtctggagtcctttgatgacgaggaccagatccaggtc
gaggtggacggactcatggaagaggtgcgtgactggcgacccgccgtgcacctctactgg
ctcgtgtggggtattgtgcaggctgtgattgaccaggaggaagacgatgagatccgagag
gagctgaacatggaaactggccagtacacgtttgagaccgaggaggagaagcagcaattg
tccgcgtcttccggctcttctgccaatctcaaaccgtccgtgagtcactcatctgcttcg
gaagtggaagaggaggaagacccctttgactacctcagctacgcgtcccagaaggcccaa
ctcttctggagcgacatgatcagattcgggctcttggacgagaaagactacaagggagtc
acccggtttattaatgcgtag

DBGET integrated database retrieval system