KEGG   Yarrowia lipolytica: YALI0E16929gHelp
Entry
YALI0E16929g      CDS       T01033                                 

Definition
YALI0E16929p
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
yli  Yarrowia lipolytica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YALI0E16929g
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YALI0E16929g
  Amino acid metabolism
   00310 Lysine degradation
    YALI0E16929g
Enzymes [BR:yli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     YALI0E16929g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:complement(2005824..2007167)
Genome map
AA seq 447 aa AA seqDB search
MLRTIRSQSMRMASASSRRMLSSAASTSMLRQTLKAPSMTAQVTRPTVMTFKPVLLSRGY
ADVVEVPPMAESLTEGTLTAFEKDIGDFVEADEEIATIETDKIDVAVNAPFAGTITEFLV
KPDDTVTVGQPLLKIERGEGSSSGGSKPPKEKKEEKTEEKEEPAPKEESAPAPKKEEAPK
KEESAPAPKKEEKKPAPKEEKKTDATEGLGGFRKEERVKMNRMRLRIAERLKESQNTAAS
LTTFNEVDMSSLMEMRKLYKDEMLKKTGTKLGFMGAFSKAAALAMRDVPAVNAAIEGPNG
GDTIVYRDYVDISVAVATPKGLVTPVVRNVDQLDVMGIEKAIHDLGVKARDNKITLEDMA
GGTFTISNGGVFGSLFGTPIINMPQTAVLGLHGVKDRAVVVDGQVVSRPMMYLALTYDHR
VLDGREAVVFLRTIKELIEDPRKMLLM
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcttagaacaatcagatcccaatccatgcgaatggcctccgcctcgtcgcgaagaatg
ctgtcttccgccgcctccacatccatgctaagacaaacgctcaaggctccctccatgacc
gctcaggtcactcgacccaccgtcatgaccttcaagcctgttctgctgtcccgaggatac
gccgacgttgttgaggtgcctcccatggccgagtctctgactgagggtactctgaccgcc
tttgagaaggacattggagactttgtcgaggccgatgaggagatcgccaccatcgagacc
gataagattgatgttgccgtcaacgctcccttcgccggaaccatcaccgagttcctggtc
aagcccgacgacaccgtcactgtcggccagcctcttctcaagattgagcgaggcgagggc
tccagcagcggtggctccaagcctcccaaggagaagaaggaggagaagacggaggagaag
gaggagcctgctcccaaggaggagtctgcccctgcccctaagaaggaggaggcccccaag
aaggaggagtctgcccctgctcccaagaaggaggagaagaagcccgctcccaaggaggag
aagaagaccgatgccaccgagggtctcggcggcttccgaaaggaggagcgagtcaagatg
aaccgaatgcgacttcgaattgctgagcgactcaaggagtcccagaacaccgccgcttct
ctgaccaccttcaacgaggtcgacatgtcctctctgatggagatgcgaaagctctacaag
gatgagatgctcaagaagaccggcaccaagcttggtttcatgggtgccttctccaaggcc
gccgctctggccatgcgagacgttcctgccgtcaacgctgccattgagggccccaacggt
ggtgacaccattgtctaccgagactacgttgacatttctgtcgccgtcgccacccccaag
ggtctggtgacccccgttgtccgaaacgttgaccagctcgacgtcatgggcattgagaag
gccattcacgacctcggtgtcaaggcccgagacaacaagatcactcttgaggatatggcc
ggcggaaccttcaccatctccaacggtggtgtttttggctctctcttcggtacccccatc
attaacatgccccagactgccgttctcggtctgcatggtgtcaaggaccgagctgtcgtt
gttgacggccaggttgtttctcgaccaatgatgtaccttgcattgacctacgatcaccga
gttctcgatggtcgtgaggctgtcgttttcctccgaactatcaaggagctcattgaggat
cctcgaaagatgctccttatgtaa

DBGET integrated database retrieval system