KEGG   Yarrowia lipolytica: YALI0E16929gHelp
Entry
YALI0E16929g      CDS       T01033                                 

Definition
(RefSeq) YALI0E16929p
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
yli  Yarrowia lipolytica
Pathway
yli00020  Citrate cycle (TCA cycle)
yli00310  Lysine degradation
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
yli01130  Biosynthesis of antibiotics
yli01200  Carbon metabolism
Module
yli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YALI0E16929g
  Amino acid metabolism
   00310 Lysine degradation
    YALI0E16929g
Enzymes [BR:yli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     YALI0E16929g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H LAP1C NPR3 RNA_pol_Rpc4
Motif
Other DBs
NCBI-GeneID: 2911643
NCBI-ProteinID: XP_504044
UniProt: Q6C5L8
Position
E:complement(2005824..2007167)
Genome map
AA seq 447 aa AA seqDB search
MLRTIRSQSMRMASASSRRMLSSAASTSMLRQTLKAPSMTAQVTRPTVMTFKPVLLSRGY
ADVVEVPPMAESLTEGTLTAFEKDIGDFVEADEEIATIETDKIDVAVNAPFAGTITEFLV
KPDDTVTVGQPLLKIERGEGSSSGGSKPPKEKKEEKTEEKEEPAPKEESAPAPKKEEAPK
KEESAPAPKKEEKKPAPKEEKKTDATEGLGGFRKEERVKMNRMRLRIAERLKESQNTAAS
LTTFNEVDMSSLMEMRKLYKDEMLKKTGTKLGFMGAFSKAAALAMRDVPAVNAAIEGPNG
GDTIVYRDYVDISVAVATPKGLVTPVVRNVDQLDVMGIEKAIHDLGVKARDNKITLEDMA
GGTFTISNGGVFGSLFGTPIINMPQTAVLGLHGVKDRAVVVDGQVVSRPMMYLALTYDHR
VLDGREAVVFLRTIKELIEDPRKMLLM
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcttagaacaatcagatcccaatccatgcgaatggcctccgcctcgtcgcgaagaatg
ctgtcttccgccgcctccacatccatgctaagacaaacgctcaaggctccctccatgacc
gctcaggtcactcgacccaccgtcatgaccttcaagcctgttctgctgtcccgaggatac
gccgacgttgttgaggtgcctcccatggccgagtctctgactgagggtactctgaccgcc
tttgagaaggacattggagactttgtcgaggccgatgaggagatcgccaccatcgagacc
gataagattgatgttgccgtcaacgctcccttcgccggaaccatcaccgagttcctggtc
aagcccgacgacaccgtcactgtcggccagcctcttctcaagattgagcgaggcgagggc
tccagcagcggtggctccaagcctcccaaggagaagaaggaggagaagacggaggagaag
gaggagcctgctcccaaggaggagtctgcccctgcccctaagaaggaggaggcccccaag
aaggaggagtctgcccctgctcccaagaaggaggagaagaagcccgctcccaaggaggag
aagaagaccgatgccaccgagggtctcggcggcttccgaaaggaggagcgagtcaagatg
aaccgaatgcgacttcgaattgctgagcgactcaaggagtcccagaacaccgccgcttct
ctgaccaccttcaacgaggtcgacatgtcctctctgatggagatgcgaaagctctacaag
gatgagatgctcaagaagaccggcaccaagcttggtttcatgggtgccttctccaaggcc
gccgctctggccatgcgagacgttcctgccgtcaacgctgccattgagggccccaacggt
ggtgacaccattgtctaccgagactacgttgacatttctgtcgccgtcgccacccccaag
ggtctggtgacccccgttgtccgaaacgttgaccagctcgacgtcatgggcattgagaag
gccattcacgacctcggtgtcaaggcccgagacaacaagatcactcttgaggatatggcc
ggcggaaccttcaccatctccaacggtggtgtttttggctctctcttcggtacccccatc
attaacatgccccagactgccgttctcggtctgcatggtgtcaaggaccgagctgtcgtt
gttgacggccaggttgtttctcgaccaatgatgtaccttgcattgacctacgatcaccga
gttctcgatggtcgtgaggctgtcgttttcctccgaactatcaaggagctcattgaggat
cctcgaaagatgctccttatgtaa

DBGET integrated database retrieval system