KEGG   Yarrowia lipolytica: YALI0E17743gHelp
Entry
YALI0E17743g      CDS       T01033                                 

Definition
YALI0E17743p
Organism
yli  Yarrowia lipolytica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:2093395..2095896
Genome map
AA seq 833 aa AA seqDB search
MTVQTSTEAVDELQPVPEACGSCESFDGCVNGHSHYPQATQAQPTQATQAQAPVASPTQP
MSSPPPTQPQPVPGSRPPGRTPSGVSSYDAPMRSSTSMGSQNGGGMILDTELPSHQDTKL
KVGSYVPSSGEETTDDEGINFMATRRFPPRTSPPREKENVHHDADTGSPHGSLEKKKSSR
GLSRLFSKTKLFDHKDHSKDHAKDDHSKRERGFSLTRRFTNKEKKDKEKDHSHPGGMDVP
KARPRTNTLDTHANLPHSTRSPSGYTRGSSVPTKSITRANTDTELSRKEQSLSSLRNGGH
ATSAGGMPLSPGTSRRYSGHQPLRPRVMTQTRQPSLPHNSDICDIPFVPSTPKYLLSPAK
IMKPSEFLPPEYNTDPPDMDICTKYAAEKKLSKTKQLGRGATAVVEKVNEIESKMVRAVK
IYNKRSADTDAKDFYDSVAEEYVISRKLQGHRNIVRVMELCLGYHDSWCCVMEFCPQGDM
FSLLESYKAQKKKMPKDERNCLFRQLLMGVAFMHRNGVAHRDIKPENLLLTDGTLKITDF
GVSVQMFDPEVPDGPIKYCAGISGSEPYISPEVFESKVSYKEDTPEQLIGRYDGRLLDVW
SCAIVFVNLVLNGGLFAKASMDDLNYKKFQDELDRYWRREENFQKFHRNELTGKGSQLDL
SDSCGNGATQMGALEAALQEEANLVSSVVPSPRQSSSNLTGMGSISRSDLRLGGGEMAPL
PYFNEMGSGLKRLIARMLMHDPRDRPYMPEIISSTSVRNIGMCFPVDNMEDYAPDQYVKG
SLAELYGYDLAIKRVTSADQTLKKEEKFVRNHNHEPLSAPPSTFGIGTFRDPY
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgcaaacctccaccgaagccgtggacgagctgcagcccgtgcccgaggcctgc
gggtcctgtgagtcattcgacggatgcgtaaatggccattcccactacccacaagcaaca
caggctcagcccacacaagcaacacaggcacaagcgccggtggcatctcccacacaacca
atgtcgtcgccgccaccgacacaaccccagccggtccccggaagtcgaccgccaggacga
acccccagcggcgtgtcgtcctacgacgctcccatgcgctcctccacgtccatgggctcc
cagaatggaggaggcatgatcctcgacacagaactgccgtcccaccaagacaccaagctc
aaggtgggctcgtacgtgccgtcatcaggcgaagagaccaccgacgacgagggtatcaac
ttcatggcgacccggcggttcccgccccgcacctcgccgcccagagaaaaggaaaacgtg
caccacgacgccgacacgggctcgccacacggatccttagaaaagaaaaaatcgtcgcga
ggactgtcccgactcttctcaaagacaaagctctttgaccataaggaccactccaaggat
cacgccaaggacgatcattccaaacgagaacgcggcttctcgctcacccgacggttcacc
aacaaggaaaagaaggacaaggaaaaggaccattcccacccgggaggcatggacgtaccc
aaagccagaccgcgaactaacacactcgacacccacgccaacctcccccactcgacaaga
tcaccctccggatacacccgtggatcctcggtgcccaccaagagcatcacccgcgcaaac
acagacacggagctatcgcgcaaggagcagtcgctgtcgtcgctgcgaaacggaggccat
gccacctctgcgggaggcatgcccttgtctcctggcacctctcgacggtactcgggccac
cagcctctgcgtccccgtgtcatgacccagacccgtcagccatcgttgcctcataatagt
gacatttgcgacatccccttcgtgccctctacccccaaatatctgctcagtcctgccaag
atcatgaaaccgtccgagtttctgcccccggagtacaacaccgatcctccggacatggac
atttgcaccaagtacgcggcggaaaagaagctgtcgaaaacaaagcagctgggccgaggt
gccacggccgtggtcgaaaaggtgaatgagatcgagtccaagatggtacgtgccgtcaag
atctacaacaagcgctccgcggacacggatgctaaggacttctacgactcggtggcagag
gaatacgtgatttcgcgcaagctgcaaggccaccgcaacattgtgcgggtcatggagctg
tgtctgggctaccacgactcgtggtgctgtgtcatggagttctgcccccagggcgacatg
ttctcactgctggagtcgtataaggcccagaagaagaagatgcccaaagacgagcgaaac
tgcctgttccggcagctgctcatgggcgtggccttcatgcatcgaaacggtgttgcccac
agagacatcaaacccgaaaacctactgctcacagacggaacgctcaaaatcaccgacttt
ggtgtctcggtgcaaatgttcgatcccgaggtgcccgacgggcccatcaagtactgtgcc
ggaatctccggttctgagccttacatctctcccgaggtgtttgagtccaaggtgagctac
aaggaagacacccctgagcagctcattggtcgatatgacggccggctgctggacgtgtgg
tcgtgtgccattgtcttcgttaacctggtgcttaatggaggtctgttcgcaaaggcctcc
atggacgacctcaactacaaaaagttccaggacgaactggaccggtactggcgcagagag
gaaaacttccagaagttccaccgtaacgagctcactggaaagggctcgcagctcgacttg
tctgactcgtgcggcaacggagctacccagatgggtgctttagaggctgctcttcaggag
gaggccaacttggtgtcttccgtggtcccctctccccgtcagtcatcttctaatctgacg
ggaatgggttccatttcgcggtccgatctgcgtcttggcggcggcgaaatggcccctctt
ccttatttcaatgagatgggttcgggtctcaagagactcattgcccggatgctcatgcac
gaccctcgagaccggccctacatgcccgagatcatttcaagcacgtctgtgcgaaacatt
ggcatgtgtttcccggtggacaacatggaggattacgcgccggatcagtacgtcaagggc
tcgctcgcagagctgtatggatacgatttggccatcaagcgggtcacgagcgccgaccag
acgctcaagaaggaggaaaagtttgtccgcaaccataatcatgagcctctcagcgctcct
cccagtacctttggtattggcactttccgggacccttactag

DBGET integrated database retrieval system