KEGG   Yarrowia lipolytica: YALI0E17787gHelp
Entry
YALI0E17787g      CDS       T01033                                 

Definition
YALI0E17787p
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
yli  Yarrowia lipolytica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:yli01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:yli00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:yli00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:yli00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:complement(2099768..2100823)
Genome map
AA seq 351 aa AA seqDB search
MSAPVIPKTQKGVIFETSGGPLMYKDIPVPVPADDEILVNVKFSGVCHTDLHAWKGDWPL
DTKLPLVGGHEGAGVVVAKGKNVDTFEIGDYAGIKWINKACYTCEFCQVAAEPNCPNATM
SGYTHDGSFQQYATANAVQAAHIPKNCDLAEIAPILCAGITVYKALKTAAILAGQWVAVT
GAGGGLGTLAVQYAKAMGYRVLAIDTGADKEKMCKDLGAEVFIDFAKTKDLVKDVQEATK
GGPHAVINVSVSEFAVNQSIEYVRTLGTVVLVGLPAGAVCKSPIFQQVARSIQIKGSYVG
NRADSQEAIEFFSRGLVKSPIIIIGLSELEKVYKLMEEGKIAGRYVLDTSK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcccgtcatccccaagacccagaagggtgtcatcttcgagacctccggcggt
cctctcatgtacaaggacatccccgtgcctgtgcctgccgacgacgagattctggtcaac
gtcaagttctccggagtctgccacacggatctgcacgcctggaagggcgactggcctctg
gacaccaagcttcctctggtcggaggccacgagggtgccggagtggttgttgccaagggt
aagaacgttgacacgtttgagattggcgactatgccggcatcaagtggatcaacaaggcc
tgctacacctgcgagttctgccaggtggccgccgagcccaactgtcccaacgctaccatg
tctggatacacccacgacggctctttccagcagtacgccaccgccaacgccgtgcaggcc
gcgcacattcccaagaactgcgatctcgccgagattgcccccattctgtgcgccggaatc
accgtctacaaggctctcaagactgccgccatcctcgctggccagtgggttgccgttact
ggtgctggaggaggactcggaacacttgctgtccagtacgccaaggccatgggctaccga
gtgctggccattgacactggcgccgacaaggagaagatgtgcaaggaccttggtgccgag
gttttcatcgactttgccaagaccaaggacctcgtcaaggacgtccaggaggccaccaag
ggcggaccccacgccgtcatcaatgtgtctgtctccgagtttgcagtcaaccagtccatt
gagtacgtgcgaaccctgggaaccgttgttttggtcggtctgcccgccggcgccgtctgc
aagtctcccatcttccagcaggtggctcgatctatccagatcaagggctcttacgttgga
aaccgagccgactcccaggaggccattgagttcttctcccgaggtctcgtcaagtcgccc
atcatcatcatcggtctgtccgagctggaaaaggtctacaagcttatggaggagggcaag
attgccggccgatacgttctggacacctccaagtaa

DBGET integrated database retrieval system