KEGG   Yarrowia lipolytica: YALI0E18260gHelp
Entry
YALI0E18260g      CDS       T01033                                 

Definition
YALI0E18260p
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
yli  Yarrowia lipolytica
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    YALI0E18260g
Enzymes [BR:yli01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     YALI0E18260g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:complement(2182313..2184619)
Genome map
AA seq 768 aa AA seqDB search
MSGNNSPINAQLFPDARDVTKDALQTFVELPECTYMKGLGSSQQAEVMACDCKPGPTACD
EDSGCINRLTSIECVRCCKGCQNKRFQGKKYASVDVISTEKKGFGLRATKDIAAGEFVYE
YVGEVIDEPTFKERTAIYTTQGVKHFYFMMLQKGEFIDATAKGGLGRFCNHSCAPNGHVE
KWVVGKRLRMGIFASRHIQRGEEVTFDYNVDRYGAEAQACYCGEKNCVGFLGGKTQTESA
SKVSGTLTAALGLTSRDINAILRGKKSAEDLRPRDLTVQDVSKVMASLMMNQEAWQVNLM
LQRIALCTDTSVQAAVMKMHGYQIFAQILTATWGDNPLGLDDSDRVNVTLMLLRVLQKWP
RITKNKISSSQIENVVKSLTSNDNSDIATIAQELLSEWANLKMAFRIPRRKIDPDGDEHS
VSRGTSEEVTKESSKSEEPNDVEVVKVNKKADNNGNGVTDSPSTRSESPFTFIPTPYSNK
TAPKGPKKAVKQPASPMVPPRSLPKGWQFANDPQGKVYYYNLELNIQQWDFPKASRASSP
STPKGPKGPKGPRGNRRDERRDNSETREPLSLQSQRESDLQRIIEQARLQEVKNNSEPAP
SASAKPVNAQAHRLTKLLAKVVPNQVSKYDVDRERAKKCSKDIVQILVDKELKRPEPMTE
ISDEKAKKIKEFVKGYMGKVVKRLEEKEGGAKDFGRGRQGNRRDSERQSDRRGRQGQSDR
DHSDNHGRKRKGEENQPYEAGPMYDDESAETSTETVKKPKVDMEIDLE
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaacaactcaccaataaacgcgcagctgttccccgatgctcgcgacgtgacc
aaggacgcgcttcagacatttgtggagctcccggagtgcacgtacatgaagggtctgggc
tcgtctcagcaggcggaagtcatggcgtgtgactgtaagcccgggcccacggcgtgtgac
gaggacagcgggtgcatcaaccgactcacttccatcgagtgtgttcggtgctgcaagggc
tgtcagaacaaacggttccagggcaaaaaatacgcatcggtggacgtgatcagcacagaa
aagaaggggtttggactgcgggccaccaaggacatcgccgccggcgaatttgtctacgag
tacgtgggcgaggtgattgacgagccgaccttcaaggagcgaacggccatctacacgacc
cagggcgtcaagcatttctactttatgatgctgcaaaagggcgagttcatcgacgctacc
gccaagggaggactgggtcggttctgcaaccattcgtgcgcgcctaatggccacgtggaa
aagtgggtcgtgggcaaacggctcagaatgggcattttcgcatctcgacacattcaaagg
ggagaagaggtcacgtttgactacaacgtggaccggtacggagccgaggcccaggcgtgc
tactgcggcgagaaaaactgtgtcggctttctcggcggaaaaacgcagacggaaagcgcc
agcaaggtctccggcaccttgaccgctgctctgggtctcacgtccagagatatcaacgcc
attctgagaggcaaaaagtcggccgaggacttgcgaccccgagacctgaccgtgcaggac
gtgtccaaggtcatggcgtctctcatgatgaaccaggaagcctggcaggtcaacctcatg
ctgcagcgtattgctctgtgcacagacacgtccgtccaggcagcagtcatgaagatgcat
ggataccagatcttcgcgcagattctgaccgccacgtggggcgacaatcctcttgggctg
gacgacagcgaccgcgtgaacgtgacgctgatgctgctgcgagtcctgcaaaagtggccg
cgaatcacaaagaacaaaatctccagttcgcagattgaaaacgtggtcaagagcctgacg
tccaacgacaacagtgacattgccaccattgcccaggagctcttgtctgaatgggcaaac
ctgaaaatggctttccgaatcccacgacgaaaaattgatcccgacggagacgagcattcg
gtctctagaggtaccagcgaggaggtcaccaaggagagctccaagtctgaggagcccaat
gatgtggaagttgtcaaggtgaacaaaaaagcagataacaacggaaacggcgttactgat
tcgccgtccacccgctcggaatcccccttcaccttcatccccaccccctactctaacaaa
acggcccccaagggccccaagaaggccgtcaagcagcctgcatcacccatggtgcctcca
aggagcctgcctaagggctggcagtttgcgaacgacccgcagggcaaggtgtactactac
aatctcgagctgaacatccaacagtgggatttccccaaggcgtcacgtgcgagctcaccc
tcgacccccaagggccccaagggccccaagggtccccgtggcaaccgtcgagacgagaga
cgggacaattccgagacccgagagccgctttctttgcagtcgcagcgcgagagtgatctc
cagcgcatcattgagcaggctcggttgcaggaggtgaaaaataacagcgagccggctccg
tctgcgtctgccaagcccgtgaacgcgcaggcgcatcggctgactaaactgctggccaag
gtggtgcccaatcaagtgtccaaatacgacgttgatcgggagcgggcgaaaaagtgttct
aaggacattgtgcagattctggtggacaaggagctgaaacgtccggagcccatgactgag
attagtgatgagaaggccaagaaaatcaaggagtttgtcaagggctacatgggcaaggtg
gtcaagcggttggaggagaaggagggtggggccaaagattttggccgtggtcgacaaggt
aaccgacgagactctgagcggcaatccgaccgacgtggtagacaaggtcagtcggaccgc
gatcactctgacaatcacggacgaaaaagaaagggcgaagaaaaccagccgtatgaagct
ggaccaatgtatgacgacgaaagtgccgaaacgtcgacggagacggtcaagaagcccaag
gttgatatggagattgatttggagtga

DBGET integrated database retrieval system