KEGG   Yarrowia lipolytica: YALI0E20185gHelp
Entry
YALI0E20185g      CDS       T01033                                 

Definition
YALI0E20185p
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
yli  Yarrowia lipolytica
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YALI0E20185g
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    YALI0E20185g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     YALI0E20185g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:2394733..2397306
Genome map
AA seq 857 aa AA seqDB search
MEELSEAERNQIGQLFICGLRNAELDEDIAELVRTFKVGSIQVSIKNLPSVDQARELIRG
VQQLAYEAGHEQPMAICIDQEGGILNNLKGVTQFPCQMALAASKDTDLVEAVAEAAAKEL
LACGINFMFAPCMDVLKSTSASADFLLGTRAFGDDHEIVSQFGCAFLRGLQKQNMMACGK
HFPGYGTASLDSILGGVPVVSDNELQMQAQAFVPFKAIIDMDCDAIMVGGCSAPGLDPTE
AHACLSWKICTDILREQLGFKNVIVSECLEMEALYQQVGVKQGTVSAKLAGCDMILCCSS
FKLQKQALEGLSGAYLDGLVEPESIMASAERVRHMKSSRNLTWQSILGERPFVAELLQEH
KLLSARAYESCVAIGRDYLHMIPFSLKRSDTILLLTPLCESDDIHSGRCTPAQTNGNGNP
SNVRLLPGEATFQHLGKTIASYHTGKTLHTSYSQNGIIKLHEQLIARATVVILVNTTAYS
NMYQTSITKYVQLLCDQRRIPFVLVAASSPHDMASSNHTSDTKTYVCAFEFTPEMQVTCA
KVMFGKLPALGTIPFSHFWGRQRSGSKSLSTTSTRKTWMVETYAGENVQPLWDLCFPKRK
LPTEAFSVLNDIDCYVVKNSSTGKLYGFCAAHKTQVALLMVDPSRRKMGIAVSLYKRVQR
AKGRKDPSAAQLTSFGSVLPAYFAGATPESLAWLQKVDRAMIFRDNVVVLVNQRLQDFRV
DAAVIQELQQNNLRFSIASVAETDAKDLPEELRESDAYVAQCLKDGSVVGSVVLFNKGSS
IARWLPWIYEFGPSVGGMTSLRCDSDLIMQGLVCCAMRSFRIEGFQTVVLDHMSVAQRDS
LSGLGFSVWRVEEKFSR
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atggaggaattatcggaggcggaacgaaaccaaatcggccagctattcatctgtggatta
cgtaatgcggagctcgacgaggacattgccgagctagtgcgcaccttcaaggttggctcc
atccaggtgagcatcaaaaacttaccttcggtggaccaggcacgcgagctcatccgcggc
gtgcaacagctggcctatgaagccggtcacgaacagcccatggcgatttgcatcgaccaa
gagggcggcattctcaacaacctgaaaggcgtgacccaattcccatgccaaatggctctg
gcagcctccaaagacaccgatctagtggaggcggtggccgaggcggcggctaaggagctc
ctagcctgtggaatcaacttcatgtttgcaccgtgtatggacgtgctcaagtcgacgtcg
gccagtgcggacttcttgctggggacccgtgcctttggagacgatcacgaaattgtgtct
caattcggatgtgctttccttcgtggactgcagaaacaaaacatgatggcctgtggaaaa
cactttccgggctacggaacagcctcgctggactccatcttggggggagtgcctgtggtc
tcggataatgagctccaaatgcaggcacaggcgtttgtgccgtttaaggcgatcatcgat
atggattgtgatgccatcatggtgggaggatgttctgctccaggtttggatcctaccgaa
gctcatgcttgtttgtcctggaagatatgcactgatattcttagagaacagctgggattc
aagaacgttattgtttcagagtgtctggagatggaggctctttaccaacaggttggagtg
aaacaaggaaccgtctcagcaaagctggctggctgtgacatgattttgtgctgctcttcg
ttcaagttgcaaaagcaagccctggaaggtctatcaggcgcctatctcgacggacttgtg
gagcccgaaagcatcatggcatctgctgaacgcgttagacacatgaagtctagcaggaat
ctcacctggcagagtattctgggagagagaccgtttgtggcagagctgttgcaagaacac
aaactgctgtctgcacgagcgtacgagtcgtgtgtggctattggcagagactatcttcac
atgattcctttttccttgaaacgctcagacacgattctactgctgaccccgttatgtgaa
tccgacgacattcacagcggcagatgcactccagcgcaaacaaacggcaacggaaaccca
tccaacgtgcgcttgcttcctggcgaagcgacttttcaacatctgggaaagaccattgcc
tcatatcatactggaaagacactgcacacttcgtattcccaaaacggaattatcaagtta
cacgaacagctgatagccagagcaacggttgtgattctggtcaacacaacagcctactcg
aacatgtatcaaacctcgataacaaagtacgtgcagcttctttgtgaccaaagacgtatt
ccgtttgtactggtggctgcttcaagcccccatgacatggcgtcctccaaccatacatcg
gatacaaagacgtatgtctgtgcgtttgaatttaccccagaaatgcaggtcacatgtgca
aaggtcatgtttggtaagcttcctgcgctgggaactatcccattctctcacttctggggt
agacaaaggtctggttccaagtcactgagtactacgtctaccagaaagacgtggatggtg
gaaacgtatgctggagagaacgtgcaacctctttgggatctatgtttcccgaaacgaaag
ctgccaaccgaggcgttctccgtgttaaatgatatcgactgctatgtggtgaaaaactcg
tctactggaaagctgtatgggttctgtgcggctcacaagacccaggttgcactactcatg
gtggacccgtccagacggaaaatgggcatagctgtgagcctgtacaagcgagtacaaaga
gccaagggcagaaaggacccctctgcggctcagctgacctcgtttgggtcggtgcttccc
gcgtactttgctggtgctacacccgagagtctggcgtggctacagaaggtggaccgggcc
atgatctttagagacaatgtggttgttctagtgaaccagaggctgcaggacttccgagtc
gatgcggctgtgatccaggagctgcagcagaacaacctccggttctccatagccagtgtt
gcagaaacagacgcaaaagaccttccggaggagctgagagagtcggatgcctatgtggcg
cagtgtctcaaggatggttcggtggtgggctcggtggtgctgttcaataagggttcttcc
atagcccggtggctgccttggatctatgagtttggtccgtcggtgggtggcatgaccagt
ttgcggtgcgactctgatttgataatgcaagggcttgtttgctgtgctatgagaagcttc
cgcattgagggctttcagacggtggtattggatcacatgagtgttgctcaacgcgacagt
cttagtgggcttggcttttctgtctggcgggtggaagagaagttcagccggtag

DBGET integrated database retrieval system