KEGG   Yarrowia lipolytica: YALI0E20867gHelp
Entry
YALI0E20867g      CDS       T01033                                 

Definition
YALI0E20867p
Orthology
K03115  
casein kinase II subunit beta
Organism
yli  Yarrowia lipolytica
Pathway
Ribosome biogenesis in eukaryotes
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:yli03008]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:complement(2473740..2474522)
Genome map
AA seq 260 aa AA seqDB search
MEDKLLEYNMTDPSSESEEVETWISHYCSSTGHDYFVEVFEDFIEDDFNLTGLMFLVPYY
KEALEMILDLEPEDPLKVPSIPMFEHSAELLYGLIHARFLLTKTGLQIMAKKYDEAQFGT
CPRYYCDGTRLLPTGRHDLPGYESVRLYCPCCCDVYVPPNSRYLNVDGAFFGTSFVGLFL
KMFPEVERNCIPLRKNIYELKLFGFRINEMSYSGPRMKWLRQYPEDPSVLDEEDKLPPPR
TDEKDDDGDVKLETDQENRA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggaggacaaactactcgaatacaacatgacagacccttcttccgagagcgaggaggtc
gagacctggatctcgcattactgttcgtcgaccggccacgattactttgtggaggtgttt
gaggatttcatcgaagatgacttcaacctgaccggcctcatgttcctagtgccctactac
aaggaggcgttggagatgattctggatctcgagcccgaagacccgctcaaggtgccatcc
atcccaatgtttgaacactcggccgaactgctctatggcctcatacacgctcgattccta
ctcaccaagacgggactgcagattatggccaaaaaatatgacgaggcccagtttggcact
tgcccacgatactactgcgacggaacacgcctgttgcccacaggccgacacgacctgccc
ggatacgagtctgtgcggctctactgcccgtgctgctgtgacgtctacgtgccgcccaac
tctcgatacctcaacgtcgacggagcctttttcggcacctccttcgtgggactcttcctc
aagatgttccccgaggtcgagcgcaactgcattcccctgcgtaaaaacatatacgagctc
aagctctttggcttccgcatcaacgagatgagctacagcggcccgaggatgaagtggctg
cgacagtacccagaggaccccagtgttctggatgaagaggacaaactacccccaccacga
accgacgaaaaggatgatgatggagatgtaaagctggagacggaccaggagaaccgggca
tga

DBGET integrated database retrieval system