KEGG   Yarrowia lipolytica: YALI0E22935gHelp
Entry
YALI0E22935g      CDS       T01033                                 

Definition
YALI0E22935p
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     YALI0E22935g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:complement(2703629..2705005)
Genome map
AA seq 458 aa AA seqDB search
MVFTQEPFDPITVKPNEKKRVAYFYDSDVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKH
MEIYRAKPATKQEMCQFHTDEYVDFLSRVTPDNMEHFAKEQAKFNVGDDCPVFDGLFEFC
GISGGGSMEGAARLNRGKCDIAINWAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRV
LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDIGAGKGKNYAVNFPLRD
GIDDTNYKNVFQPVIKAIMEWYQPTVVVLQCGGDSLSGDRLGCFNLSMQGHANCVNYVKS
FGLPVLVVGGGGYTMRNVSRTWTFETGLLLNKMVGPDIPYNDYYEYYGPDYKLEVRPSNM
QNANSPEYLDKILTQVLVNLGRTKFAPSVQMTDVPRDAPDDGDEEEDSAKAKDTKGGSQM
AIDEQIEHPNEFYDDDNLEGGDAKDINNFKDKDVAMED
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggtatttacgcaagagccgtttgaccccatcacggtcaagcccaacgaaaaaaaacgg
gtggcgtacttctacgactcggatgtcggcaactacgcctacggcgccggccaccccatg
aagccccacagaatacgaatggcccactcgctcatcatgaactacggtctctacaagcac
atggagatctaccgggccaagcctgccaccaagcaggaaatgtgccagttccacacggac
gagtacgtcgatttcctgtcgcgcgtcactccggacaacatggagcactttgctaaggag
caggcaaagttcaacgtcggagacgattgtcccgttttcgacggtctgtttgaattctgc
ggaatttccggcggaggatctatggagggagccgcccggcttaacagaggcaagtgtgat
attgccatcaactgggccggaggactccatcacgcaaagaaatccgaggcgtccggattc
tgctacctcaacgacattgtgctgggcatcatcgagctgctcagataccacccccgagtc
ctgtacattgatatcgacgtgcaccacggagacggagttgaggaggctttttacaccacg
gaccgagtcatgacgtgctcgttccacaagtacggagagtttttccccggtacaggtgag
ctgcgggacatcggagccggaaagggcaaaaactacgcagtcaacttcccgttgcgagac
ggaatcgacgacacaaactacaaaaacgtgttccagcccgtcatcaaggccatcatggag
tggtaccagcccactgtcgttgtcctgcaatgcggtggtgactcgctgtcgggtgaccgt
cttggatgtttcaacctgtccatgcagggtcatgccaactgcgtcaactacgtcaagtcc
tttggtttgccggttctggtggtcggaggaggaggctacacaatgcgaaatgtgtcaagg
acgtggacttttgagaccggtctgcttctcaacaagatggtgggcccggatatcccctac
aacgattactacgaatactacggacccgactataagctcgaggtgcgaccttctaacatg
cagaatgccaactctcccgagtacctggacaagattctcacccaggtgcttgtcaacctt
ggtcgaaccaagtttgcaccttctgtgcagatgaccgatgtgccccgagacgctcctgat
gatggagatgaagaggaggactcggccaaggccaaggacactaagggcggctcccagatg
gccattgacgagcagattgagcaccccaacgagttttacgacgacgataacctcgagggt
ggagatgccaaggacatcaacaacttcaaggacaaggatgtcgccatggaggactaa

DBGET integrated database retrieval system