KEGG   Yarrowia lipolytica: YALI0E23265gHelp
Entry
YALI0E23265g      CDS       T01033                                 

Definition
YALI0E23265p
Orthology
K14298  
mRNA export factor
Organism
yli  Yarrowia lipolytica
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    YALI0E23265g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:2735233..2736333
Genome map
AA seq 366 aa AA seqDB search
MSSVFGSARTTSGFGGLTQTSSAGTVQDMANDPTLANPPEDSVSDICFSPQAEFLSVASW
DKKVRIYEVSPQGQSRGVALYDHQAPVLSTHWSLDGTKVASGGCDNAVRVFDMQSQQAQQ
VGQHESSVRCVRFVAAGPSDTPILASAGWDKKLHYWDLRTPNPVSTIALPERAYSMDTSK
QLLVVATAERHILAINLSNPGAVAKTLQSSLKFQTRVVSCWPAGDGFAVGSIEGRCGIQY
VDDTQAKNKNFSFKCHRQTPNPSKNEVDIYAVNAISFHPQEGTFCTAGADGSLTFWDKDS
RHRLKGYPQLGCTIPATAFNRDGSIFAYAQSYDWSKGHSYNNKDIPHTVRFHQTKAEEVK
AKPKRR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtctagcgtgtttggaagcgcaagaactacttcgggtttcggcggcctgacccaaacg
tcctcggccggcacggtccaggatatggccaatgaccccactctagccaatccgccggaa
gactctgtgtccgacatttgcttctctccacaggccgagtttctgtcggtggcgtcgtgg
gacaaaaaggtgcgcatctacgaggtgtctccgcagggccagtcaaggggagtggctctc
tacgaccaccaggcgccagtgctgtccacccactggtctttggacggaaccaaggtggcg
tctggaggctgtgataacgccgtgagggtgtttgacatgcaatcgcaacaggcgcagcag
gtcggccagcacgagtcgtccgtccgatgcgtgcgattcgtcgccgctggaccttcagac
acacctattctggcatccgcaggatgggacaagaagctgcactactgggacctgcgaact
cccaaccccgtgtccaccattgcgctgcccgagcgggcgtactccatggacacgtccaag
cagctgcttgttgtggcgaccgctgagcgacacattctggccatcaacctcagcaacccc
ggagccgtggccaagacgctgcagtcgtctctcaagttccagacccgtgtggtctcctgc
tggcccgccggcgacggctttgccgtgggctctatcgagggccgatgcggcattcagtac
gtggacgacacacaggctaagaacaagaacttctcgttcaagtgccaccgacagaccccc
aacccgtcaaagaacgaggtcgacatctacgccgtcaacgccatctcgttccatcctcag
gagggtactttctgcacggccggtgcagatggatcgctcaccttctgggacaaggactcc
cgccacagactcaagggctacccacaactaggatgcaccattcccgccacagccttcaac
cgcgacggctctatattcgcgtacgcacagtcgtacgactggagcaagggccactcatat
aacaacaaggacatcccccacacggtgcggttccaccagacaaaggccgaggaggttaag
gccaagcccaagcgaagatag

  All links  
No link information was found.   
DBGET integrated database retrieval system