KEGG   Yarrowia lipolytica: YALI0E23496gHelp
Entry
YALI0E23496g      CDS       T01033                                 

Definition
YALI0E23496p
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     YALI0E23496g
Protein kinases [BR:yli01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   YALI0E23496g
Exosome [BR:yli04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YALI0E23496g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:complement(join(2763275..2764344,2764698))
Genome map
AA seq 356 aa AA seqDB search
MSKPKPSEVRTLAFNVSDHYQILDMVGEGAYGIVCSALHTPSGQKVAIKKITPFGRSMFC
LRTLREIKLLRHFSHENIIGILDVQKPASFESFNEVYLIQELMDTDLHRVIRTQELSDDH
CQYFVYQTLRAIKALHSANVLHRDLKPSNLLLNASCDLKICDFGLARSAASTEDNFGFMT
EYVATRWYRAPEIMLTFKEYTKAIDMWSIGCILAEMLGGRPLFPGRDYHSQLTMILDVLG
TPTMEDYYSVKSRRAREYIRSLPFKKKLPFSQLFPKANPLAIDLLEKLLTFNPAKRITVE
EALVHPYLEQYHDADDEPTAEPIPDEFFDFDRNKDELSVEQLKTLIYNEIMYWKRP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaccaaaaccctccgaggtccgaaccctggcgttcaacgtgtccgaccactac
cagatcctggacatggtcggagaaggcgcatatggcattgtgtgttccgcgttgcacacg
ccctccggccagaaagtggcaatcaaaaagatcacgccgtttggccggtccatgttctgt
ctccggactctacgagagatcaagctgctgcgccacttcagccacgaaaacatcattggc
attctggacgtgcaaaagcccgcgtccttcgagtcctttaacgaggtctacctcattcag
gagctcatggacacagatctgcatcgggtgatccgaacccaggagctgtccgacgaccac
tgccagtactttgtgtaccagacgctgcgagccatcaaggcactgcactcggcaaacgtg
ttgcatcgggacctcaagcccagcaacctgctcctaaacgcgtcgtgtgacctcaagatt
tgcgactttggcctggcccgatcggcagcgtccaccgaagacaactttggcttcatgacc
gagtacgtggcgacccggtggtacagagcgcccgaaatcatgctcacgttcaaggagtac
acaaaggccattgacatgtggtcgattgggtgcattttggcagagatgctgggcggccgg
cctctgttccctggcagagactaccactcgcaactgaccatgattctggacgttctgggc
acacccaccatggaagactactactcggtcaagtcgcggcgtgcacgggagtacatccgg
tcgctgccgttcaagaagaagctgccgttttcgcagctgttccccaaggcgaatcctctg
gcaattgatctgcttgagaagctgctgacgttcaacccggccaagcgaatcaccgtggag
gaggctctggtgcacccgtatctggagcagtaccatgatgccgacgatgagcctaccgcc
gaacccattcccgacgagtttttcgactttgaccggaataaggatgagctgagtgtggag
cagctcaagacactgatttacaacgagatcatgtactggaagaggccgtaa

DBGET integrated database retrieval system