KEGG   Yarrowia lipolytica: YALI0E24431gHelp
Entry
YALI0E24431g      CDS       T01033                                 

Definition
YALI0E24431p
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
yli  Yarrowia lipolytica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YALI0E24431g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     YALI0E24431g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:2910375..2913197
Genome map
AA seq 940 aa AA seqDB search
MYRRPAKRRVPNPDVLLAPFKPLTQNLPPKTDPKPSISESSDSECASDDDEQEKLRVKRR
KLKEQQEEEERQKQEAEKKRQAELREQNRRISKEEAAQMLKAVAEPKRARQADLGVLRSA
EEIEQELQIRERKERVESERISARNLSFNALYRKKLGHKKKHKTWDGDGIVVVKGETLSL
YTPEGKGIVRGFKLQPQVVVEEGQVLKVGPLEIELESTVVEAQRGVLGMVEDIESRTAVE
KGRSASALRESPVPTNDTPEPLSVEATSAVVTETYTLPAPTTFKAVKRLRVKLPQKITEE
NFATFIQDVKIDPLLNTALRPHQREAVDFLYRCVMGFNPTSGYGALLADEMGMGKTLMSI
ALIWTLLKQTPLKGEPPLAKRVLIVCPVTLVNNWKTEIKKWLGPSRLGVMAITDSMSIDL
GTVIRDFTYGRVNQVMIIGYERLLRISDQLQSANFDLVICDEGHRMKTAGNKAANAIQSL
GVARKIILSGTPIQNDLKEFFVMVDFLNPGLLGSFQQFNKDYIIPIVRSRAPDAFPSELE
KGQKQSARLSSITGQFILRRTADILSRFLPPKTETVLFCLPNAQQTEIYTKLSSEYLNRL
ERHQVDSFKSILSLRKVCNSPILLSEDGPALDSGKAYLRNSGKMNTLFRMIGQLRARNKM
DPDNAEKVVIVSSFTQTLDVIEGLVKDLKLSFTRLDGSVQASARAKIVKQFNSSSADSCF
VFLLSARAGGVGINLIGASRLFLFDPDWNPAVDLQAMARIHRDGQKKPVYIYRLLTTGCI
DEKIFQRQTIKTGLANSLIEGTEEADTFTDEELKKLFSMDVLTHCNTHDLMECKCEHNGG
DLGEVVEEVQVTKATASDSFTTARELEKNQDKQQRSLKSLLEYKHISPDVVREQWDSLSE
IGDVLLEKIVGEKNDLVSYILTKTSVQALDEVDTVDVVEE
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgacgccctgcgaagcgccgggtgcccaatcccgatgttcttttggcgcctttc
aagccgctgacgcaaaatctgcctccaaaaaccgaccccaaaccctcaatatcagaatcg
tccgactcggagtgtgccagtgacgatgatgaacaggaaaagctgcgggtcaaacgacga
aagctgaaggagcaacaggaggaggaagagcgccagaaacaggaagctgaaaagaaacga
caggccgaactccgggagcaaaaccgacgcatttcaaaggaagaagcggcccagatgctc
aaggccgtggcagaaccaaaacgtgccagacaagcggatctgggtgtgctgaggtctgcc
gaggagattgaacaggagctccagatccgggagcgcaaggaacgcgtggagtccgagaga
atcagcgccagaaacctctcgttcaatgctctgtatcgaaagaagctggggcacaaaaag
aagcataagacatgggatggagatggaatcgtggtcgttaagggagaaacactgtcgctc
tacacccctgaaggtaaggggatcgttcggggtttcaaattgcagccccaggtagtcgtt
gaagagggtcaggtgctgaaggtgggtcctctagagatcgaacttgaaagtaccgtggtg
gaggcccaaagaggagtgctaggcatggtggaggatattgagtcacgtacagcagttgag
aaaggtcgttctgcttccgcattacgtgagtctcctgttccaacaaatgatactccagag
ccattgtcagttgaagcaacttcagcggttgtgacggaaacatacacgcttcctgctccc
acgactttcaaggcagtgaaacgtctacgtgttaaactaccacagaagatcacagaggaa
aactttgcgacattcattcaggatgtcaaaattgaccctctgttgaacactgcccttcgg
cctcatcagcgcgaagcagtcgactttttgtaccgttgtgtgatgggtttcaaccccaca
tcaggctatggagctctcttggccgacgaaatgggtatgggtaaaacactgatgtcgatt
gctttaatttggacgctattgaagcagactccgctcaaaggggaacctcctctagctaaa
cgagtgctgattgtctgtcctgtgactctagtgaacaactggaagactgaaatcaagaaa
tggttgggcccttcacgactaggtgttatggccattactgacagtatgagcattgatctg
ggaacggtgattcgagatttcacctatggacgggtaaaccaggtgatgattatcggctac
gaacgtctcctgcgaatttctgatcagttgcagtctgccaactttgatctggtcatctgt
gacgaaggtcatcgaatgaaaactgccggaaacaaagccgctaatgccatccagagtctg
ggggtcgcccgaaagatcattctcagtggtactccgatccagaacgatctcaaggagttc
tttgtcatggttgatttcctcaatcccggtctactgggctctttccagcagttcaacaaa
gactacataattcccattgtgcggtctcgtgcacccgatgcattccccagtgagctcgaa
aagggtcaaaaacagtctgctcgattgtcgtcaatcactggccagttcattttacgtcga
actgctgacattttgtctcgcttcttgccccccaagactgagactgttctcttctgtctc
cccaacgcccagcaaacggaaatatacaccaagctgtcttccgagtatctgaatcgactc
gaacgccaccaagttgactcgttcaagtcgatactgtcactcagaaaagtgtgtaactcg
cccattcttttgtctgaggatggaccagccctagactcgggaaaggcatatttgcgtaac
tctggtaagatgaacacgctgtttcgcatgattggtcaactgcgagcacgtaacaagatg
gatcctgacaacgcagagaaggttgtcattgtatcgtcctttacgcaaactctggatgtt
attgaggggctggtaaaggaccttaagctgtcattcactcgtctggatggatccgtacaa
gcttctgcacgtgccaagattgtcaaacaattcaattcttcttccgcagatagctgtttt
gtgtttctcttgtcggcgcgagctggaggagtgggtatcaatctgattggtgcgtctcga
ttgttcctgtttgacccggattggaatcctgctgtcgacttacaagccatggctcgtatc
catcgagatggccagaagaagcccgtgtatatctaccgtctccttactactggatgcatt
gacgagaagattttccagcgacaaactatcaagaccggtctggccaactccctgattgaa
ggcacagaagaggctgatacgttcacggatgaggagctcaagaaactcttctctatggac
gtgctgacccattgtaatacgcatgacttaatggagtgcaagtgtgaacacaatggaggt
gatctgggagaggtggttgaggaagtgcaagtgaccaaggccacagcttcagattcgttc
actacggctcgtgaactggagaagaaccaagacaaacaacagaggagtctcaagagtttg
ctggaatacaagcatatcagtccagatgttgttcgtgagcaatgggacagtctgtctgag
attggagatgtgttgctggagaagattgtgggagagaagaatgatttggttagttatatt
ctgaccaagacttcagttcaagcgttagacgaggttgatacggtggacgttgtggaggaa
tga

DBGET integrated database retrieval system