KEGG   Yarrowia lipolytica: YALI0E24893gHelp
Entry
YALI0E24893g      CDS       T01033                                 

Definition
YALI0E24893p
Orthology
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     YALI0E24893g
Protein phosphatases and associated proteins [BR:yli01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YALI0E24893g
Messenger RNA biogenesis [BR:yli03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     YALI0E24893g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:complement(2971520..2973766)
Genome map
AA seq 748 aa AA seqDB search
MDQVQLGDYDSASISGQIAERMAQPIKTEFDTNFVPQTLSLVDLEHVNGKRKFEETDTPE
FDTQRARELILDADVNPALKAPQLRYIPLKTGVCYDVRMRYHARLVSTSYDYVDPHPEDP
RRIFSVYKALVDAGLVVDPEYLGLEDIGPLMEKIPIREASLDEVLEVHTPAHVDFLASTE
KMNRPQLLEEGEKGDSVYFNNESFSAGKLSCGGTIETCRAVIERNVKNAIAVVRPPGHHA
EPGNPAGFCMFSNVAVAAKVLLKRYPERVKRILILDWDVHHGNGTQRAFLDDPRVLYISL
HQYENGKFYPGGTFGAHTSVGTGAGEGYSVNIPWSAPGAGDADYIYAFQKVVMPIGMEFD
PDFVIVSAGFDAAEGDLLGGCKITPSGYGHMTHMLKGLASGNLAVVLEGGYTLEATAKSA
LAVTKVLLGEAPLPLPAAFKPTSATISVVQDVVETQSQYWRCLQPGFETIIPKEITTYDL
MGDVVRSYQARKLFDKYKLSALPNMGGSSSTPSGRAATAGPASGSSISLADQILASPKIH
SAETVVVFVHDPPQIWGKVDAVTGELDFDSCMVDVTTKWLEWAHGRGYGIIDVNIPKALN
GADDDNYYALFASQEVCLYLWDKYLSVFDAQNVIMVGFGDAYAGLVHLVGHRDTREKVNC
VINFISETQLRPIVSIIDEYITDWFYRSSLVFTADTHPCWDVSTNPKKPRRKFGRVLRCD
STGLHRIVEERFKEAVEFIDEQLEDDEE
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggtgcagctaggggactatgacagcgcttccatctccggccagattgctgag
cgaatggcgcagcccatcaagacggagttcgataccaactttgtgccccagactctgtcg
ctggtggacctggagcacgtcaacggcaagcgtaagtttgaggagacagacacgcctgaa
ttcgacacacaacgcgcccgtgaactcatcctcgacgcagacgtcaacccagccctcaag
gctcctcagctgcgttacattccgctgaaaactggagtctgttacgacgtgcgaatgcga
taccatgctcgtctggtgtccacatcctacgactacgtggaccctcatccagaggacccg
agacgtattttctcagtgtacaaggcgctggtggatgcaggactagtggtggatcccgag
tatctaggtctggaggacattggcccactgatggaaaagattccgatccgagaagcctcg
ctcgacgaggttctggaggtgcatacccccgcacatgtggacttcctagcgtcgacggag
aagatgaaccgaccgcagttactggaggagggcgaaaagggcgactcggtctatttcaac
aatgagtcgttcagtgcaggcaaattgtcctgtggaggaaccattgagacgtgtagagcc
gtgatcgagcggaatgtcaagaacgccattgccgtcgttcgtccaccaggccatcacgcc
gagcctggcaaccctgctggcttttgcatgttttccaacgtggctgtggctgccaaggtg
ctactgaaacggtaccctgagcgagttaagcggatcctgattctcgactgggatgttcat
cacggaaacggtacccaacgagcctttctggatgaccctagggtgctttacatttctctg
caccagtacgagaacggaaaattctaccctggaggcacatttggagctcacacgtctgtg
ggaactggagctggagagggatacagtgtcaacattccctggagtgcccctggagctggc
gatgcagactacatttacgcattccaaaaagtcgtcatgccaattggtatggagtttgac
cctgattttgtgattgtgtcagctggtttcgacgcagccgagggtgatcttcttggtggg
tgcaagattacgccttcgggatatggtcacatgacccacatgctcaagggcctggcttct
ggaaacctggctgtggtgctggagggaggttacactttggaggccactgccaagtctgcc
ttggccgtcaccaaggtgcttcttggagaggcgcctcttcctcttcctgcggccttcaag
cccacctctgcaactatctctgttgtccaggatgtggtcgagacccagtctcagtactgg
cgatgtctgcagcctggctttgagactatcattcccaaggagatcaccacgtacgatctg
atgggtgacgtcgttcgatcctaccaggcacgcaagctgttcgacaagtacaagctatcg
gctcttccaaacatgggaggaagcagcagtacgccatctggacgggctgccactgctggt
cctgcttcaggatcgtcaatctctctggcagaccagattcttgcatcaccaaaaatccac
tcggccgaaaccgtggttgtgtttgtgcatgatcctcctcagatctggggtaaggtggac
gctgtcactggcgagcttgactttgattcctgcatggttgacgtgacgacaaagtggctg
gagtgggcacatggacggggatacggtatcattgacgtcaacattcccaaggctttgaat
ggagctgacgacgacaactactatgcactgtttgccagccaggaggtgtgcctgtatctg
tgggacaagtacctcagtgtgtttgacgcgcagaacgtgatcatggtgggctttggtgat
gcctacgctggtctggtgcatctggtaggccaccgagacacccgagaaaaggtcaactgc
gtcatcaacttcatctccgagacccagctgcgccctattgtctccattattgacgagtac
atcaccgactggttctaccgatcgtcactggttttcactgcggacacccatccctgctgg
gatgtgagcactaaccccaagaagccaaggcgtaagtttggacgagtgctccgatgtgac
agcaccggtctacatcgaattgtggaggaacggttcaaggaagcagttgagttcattgac
gagcagctggaggatgatgaggagtag

DBGET integrated database retrieval system