KEGG   Yarrowia lipolytica: YALI0E26455gHelp
Entry
YALI0E26455g      CDS       T01033                                 

Definition
YALI0E26455p
Orthology
K11252  
histone H2B
Organism
yli  Yarrowia lipolytica
Brite
Exosome [BR:yli04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YALI0E26455g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
E:complement(3141851..3142270)
Genome map
AA seq 139 aa AA seqDB search
MAPKVAEKKPSLAGKAPAGKAPAEKKEAGKKTTTATGEKKKRTKARKETYSSYIYKVLKQ
THPDTGISTRAMSIMNSFVNDIFERVATEASKLATYTKKSTITSREIQTAVRLILPGELA
KHATGDGTRAVAKYSTFDN
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggcccctaaagttgctgagaagaagccctcccttgccggaaaggcccctgccggaaag
gcccctgctgagaagaaggaggctggcaagaagaccaccaccgccaccggcgagaagaag
aagcgaactaaggcccgaaaggagacttactcttcttacatctacaaggtgctgaagcag
acccaccctgacactggtatctccacccgagccatgtctatcatgaactcctttgtcaac
gacatctttgagcgagtcgccaccgaggcctccaagctggccacctacaccaagaagtcc
accatcacttctcgagagatccagaccgctgtccgactcattctccccggtgagctcgcc
aagcacgccactggtgacggtactcgagctgttgccaagtactctacctttgacaactaa

DBGET integrated database retrieval system