KEGG   Yarrowia lipolytica: YALI0E26455gHelp
Entry
YALI0E26455g      CDS       T01033                                 

Definition
(RefSeq) YALI0E26455p
  KO
K11252  histone H2B
Organism
yli  Yarrowia lipolytica
Brite
Chromosome [BR:yli03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    YALI0E26455g
Exosome [BR:yli04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YALI0E26455g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa CENP-W
Motif
Other DBs
NCBI-GeneID: 2912377
NCBI-ProteinID: XP_504425
UniProt: Q6C4I7
Position
E:complement(3141851..3142270)
Genome map
AA seq 139 aa AA seqDB search
MAPKVAEKKPSLAGKAPAGKAPAEKKEAGKKTTTATGEKKKRTKARKETYSSYIYKVLKQ
THPDTGISTRAMSIMNSFVNDIFERVATEASKLATYTKKSTITSREIQTAVRLILPGELA
KHATGDGTRAVAKYSTFDN
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggcccctaaagttgctgagaagaagccctcccttgccggaaaggcccctgccggaaag
gcccctgctgagaagaaggaggctggcaagaagaccaccaccgccaccggcgagaagaag
aagcgaactaaggcccgaaaggagacttactcttcttacatctacaaggtgctgaagcag
acccaccctgacactggtatctccacccgagccatgtctatcatgaactcctttgtcaac
gacatctttgagcgagtcgccaccgaggcctccaagctggccacctacaccaagaagtcc
accatcacttctcgagagatccagaccgctgtccgactcattctccccggtgagctcgcc
aagcacgccactggtgacggtactcgagctgttgccaagtactctacctttgacaactaa

DBGET integrated database retrieval system