KEGG   Yarrowia lipolytica: YALI0E29953gHelp
Entry
YALI0E29953g      CDS       T01033                                 

Definition
(RefSeq) YALI0E29953p
  KO
K03858  phosphatidylinositol glycan, class H
Organism
yli  Yarrowia lipolytica
Pathway
yli00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
yli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
    YALI0E29953g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-H Vac7
Motif
Other DBs
NCBI-GeneID: 2911453
NCBI-ProteinID: XP_504573
UniProt: Q6C439
Position
E:3544718..3545377
Genome map
AA seq 219 aa AA seqDB search
MPCTQSPYKDYHYEERRVGSSVEFTVKNLSKTRAKIITTYATCLLNKVVVVLLMLATTSI
WLEEHKPAYQYVGESTLSKIATAYPQWLLGFLRNKTPTIALLSLWVLAIMALMKRPYKIE
SLFVVHGIGLQVYSSGGYYFMGQTTFLNLDSIIDLVIHEGFKGLEVIFFMTILVKDKDRT
VVIFPDLLPRRELLERVWRESRTCLYSDQPERFRKPELK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgccatgtactcaatcgccatacaaggactatcattatgaagagcgtcgcgttggctct
tcggtcgaattcactgtcaaaaatctgtcaaaaacgcgcgccaaaataatcaccacatat
gccacatgtctattaaacaaggtcgtcgtggtcttgctgatgctggcaacaacaagtatc
tggctggaggaacacaaacctgcctaccaatatgtgggcgagtcgaccctttcaaagatc
gcgacagcctatcctcaatggttgctcgggtttcttcgaaacaaaacaccaaccatcgca
ctcttgtctttgtgggtcctggctataatggcactcatgaaacgtccatataagattgag
tccttgtttgtggtccacggaattggcctgcaagtgtattcgtcgggtggctactatttc
atgggtcagacgacgttcctgaacctcgatagcatcatcgatctcgtgattcacgaaggg
ttcaaggggttggaggtgatattctttatgaccattctcgttaaagacaaggaccgaact
gtggtcatattccccgatttgctccctcggcgggagctcctggagagagtctggagagaa
agtcgaacatgcttgtattctgaccagcctgaacggttccgcaaacctgaattgaagtag

DBGET integrated database retrieval system