KEGG   Yarrowia lipolytica: YALI0F00484gHelp
Entry
YALI0F00484g      CDS       T01033                                 

Definition
YALI0F00484p
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
yli  Yarrowia lipolytica
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    YALI0F00484g
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     YALI0F00484g
Exosome [BR:yli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YALI0F00484g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:65529..67040
Genome map
AA seq 503 aa AA seqDB search
MSSYVGALDQGTTSTRFILFSPDGKPVASHQIEFTQIYPHPGWVEHDPEELVSSCLECMS
SVAKEMRTQGIKVADVKAIGITNQRETTVLWDIETGQPLYNAIVWSDARTGDTVKKLEAQ
PGADEIPKLCGLPLSTYFAGVKVRWILDNVKEARECYDRGKLAFSTIDSWLLYNLTGGLN
GGAHITDTSNASRSMFMNIETLKYDEKLIKFFGVEKLILPKIVSSAEVYGRIGTGPFANI
PLAGCLGDQSAALVGQKAFEPGQAKNTYGTGCFLLYNAGEKPIISNNGLLTTVGYHFKGQ
KPVYALEGSISVAGSCIKWLRDNIGLIESSEQIGELASQVDDSAGVVFVTALSGLFAPYW
RTDARGTILGLTQFTTKAHICRAALEATCFQTRAILDAMAKDSGKPFTKLRVDGGMTNSD
IAMQIQADILGIEVERPAMRETTALGAAIAAGFAVGVWKSIEDLKDINTEGMTEFASKTN
EEERAAMMKQWNRGIERAVGWLE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctacgtaggagctctcgaccagggtaccacctccacccgtttcattctcttt
tcgcctgacggcaagcccgtggcatcccaccagatcgaattcacccagatctacccccac
cccggatgggtggagcacgaccccgaggagctcgtgagctcgtgtctggagtgcatgtcg
tcggtggccaaggaaatgcgaacccagggcatcaaggtggccgacgtgaaggcgatcgga
atcaccaaccagcgagaaaccaccgtgctttgggacattgagaccggccagcccctgtac
aacgccattgtgtggtccgacgcccgaaccggcgacaccgtcaagaagctcgaggcccag
cccggcgctgacgaaatccccaagctctgtggcctgcccctgtccacctactttgccgga
gtcaaggtccgatggatcctggataacgtcaaggaggcccgagagtgctacgatcgaggc
aagctggccttctccaccatcgactcgtggctgctctacaacctcacgggcggcctcaac
ggcggcgcccacatcaccgacacctccaacgcctcccggtccatgttcatgaacattgag
accctcaagtacgacgagaagctcatcaagttctttggcgtcgagaagctcattctcccc
aagattgtctcgtccgccgaggtctacggccgaatcggaaccggccccttcgccaacatc
cccctggccggctgtctcggtgaccagtccgccgccctcgtcggccagaaggcctttgag
cccggccaggccaagaacacatatggaaccggctgcttcctgctctacaacgccggcgag
aagcccatcatctccaacaacggcctgctgaccaccgtcggctaccacttcaagggccag
aagcccgtctacgctctggagggctccatctccgtcgccggctcgtgcatcaagtggctg
cgagacaacattggtctcattgagtcttccgagcagattggagagcttgcctcccaggtc
gacgactctgccggcgtggtgtttgtcaccgctctgtccggcctgtttgccccctactgg
cgaaccgacgcccgaggcaccattctgggtctcactcagttcaccaccaaggcccacatt
tgccgagccgccctggaggctacttgtttccagacccgggccattctcgacgccatggcc
aaggactctggtaagcccttcaccaagctgcgagtcgacggaggaatgaccaactcggac
attgctatgcagatccaggccgacattcttggcattgaggtcgagcgacccgccatgcga
gagaccaccgctctgggtgccgccattgctgccggctttgccgttggcgtgtggaagtcc
attgaggatcttaaggacatcaacaccgagggcatgaccgagtttgcttccaagaccaac
gaggaggagcgggccgccatgatgaagcagtggaaccggggcattgagcgagctgttggc
tggcttgagtaa

DBGET integrated database retrieval system